FOXS1 Antibody

Product Discontinued

FOXS1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FTRQTGAEGTRGPAKARRGPLRATSQDPGVPNATTGRQCSFPPELPDPKGLSFGGLVGAMPASMCPATTDGRPRPPMEPK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FOXS1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1 - 4 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FOXS1 Antibody

• FKHL18
• forkhead (Drosophila)-like 18
• forkhead box protein S1
• forkhead box S1
• Forkhead-like 18 protein
• forkhead-related activator 10
• Forkhead-related transcription factor 10
• forkhead-related transcription factor FREAC-10
• FREAC-10
• FREAC10forkhead-like 18 (Drosophila)
• MGC4544

Background

The forkhead family of transcription factors belongs to the winged helix class of DNA-binding proteins. The protein encoded by this intronless gene contains a forkhead domain and is found predominantly in aorta and kidney. The function of the encoded protein is unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FOXS1