Forkhead box I2 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_899016). Peptide sequence AQAGGELDMAGFCDSLGSCSVPHGLTRAIAHPPSYGRTDLSSGRRLWVNS |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
FOXI2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
34 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Forkhead box I2 Antibody - BSA Free
Background
Forkhead box I2 is one of a range of Investigative Grade antibodies, made against targets that have limited or no commercial antibodies available to them and for which there are no data on the expression of the protein in the range of common cell lines and tissues available to us. These antibodies are affinity purified using their peptide immunogen and are known to give low background staining in a western blot. However no additional claims are made for their ability to recognise native protein in any application.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Mu, Rt
Applications: PEP-ELISA, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ha, Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: BA
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Publications for Forkhead box I2 Antibody (NBP3-09208) (0)
There are no publications for Forkhead box I2 Antibody (NBP3-09208).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Forkhead box I2 Antibody (NBP3-09208) (0)
There are no reviews for Forkhead box I2 Antibody (NBP3-09208).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Forkhead box I2 Antibody (NBP3-09208) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Forkhead box I2 Products
Blogs on Forkhead box I2