Home » FNBP1L » FNBP1L Research Products » FNBP1L Recombinant Protein Antigen

FNBP1L Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for FNBP1L Recombinant Protein Antigen (NBP2-49439PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

FNBP1L Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FNBP1L.

Source: E. coli

Amino Acid Sequence: QNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERKVIPII
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FNBP1L
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-49439.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for FNBP1L Recombinant Protein Antigen

  • C1orf39
  • chromosome 1 open reading frame 39
  • FLJ20275
  • formin binding protein 1-like
  • formin-binding protein 1-like
  • Toca-1
  • TOCA1Transducer of Cdc42-dependent actin assembly protein 1
  • transducer of Cdc42-dependent actin assembly 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Cip4 Antibody (1A9)
H00009322-M01
Immunoprecipitation: Cip4 Antibody (1A9) [H00009322-M01] - Analysis of TRIP10 transfected lysate using anti-TRIP10 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TRIP10 MaxPab rabbit polyclonal antibody.
Immunocytochemistry/Immunofluorescence: Cip4 Antibody (1A9) [H00009322-M01] - Analysis of monoclonal antibody to TRIP10 on HeLa cell . Antibody concentration 10 ug/ml.
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
N-WASP Antibody
NBP1-82512
Immunocytochemistry/Immunofluorescence: N-WASP Antibody [NBP1-82512] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512] - Staining of human cerebral cortex shows moderate to strong positivity in neuronal cells.
Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512] - Staining of human kidney shows moderate to strong positivity in cells in tubules and glomeruli.
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
FNBP1 Antibody
NBP2-48542
Immunohistochemistry-Paraffin: FNBP1 Antibody [NBP2-48542] - Staining of human appendix shows strong cytoplasmic positivity in lymphoid tissue.
Immunohistochemistry-Paraffin: FNBP1 Antibody [NBP2-48542] - Staining of human lymph node shows high expression.
Western Blot: FNBP1 Antibody [NBP2-48542] - Staining of human skeletal muscle shows low expression as expected.
Species: Hu
Applications: IHC, IHC-P, WB
WASP Antibody
NB300-996
Immunohistochemistry-Paraffin: WASP Antibody [NB300-996] - Staining of paraffin embedded Human Spleen. Antibody at 5 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunocytochemistry/Immunofluorescence: WASP Antibody [NB300-996] - Immunofluorescence analysis of paraformaldehyde fixed HepG2 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing nuclear and cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
Immunocytochemistry/Immunofluorescence: WASP Antibody [NB300-996] - Immunofluorescence analysis of paraformaldehyde fixed U2OS cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing nuclear and cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
ACTR2 Antibody
(1B10-C4)
H00010097-M01
Western Blot: ACTR2 Antibody (1B10-C4) [H00010097-M01] - Western Blot analysis of ACTR2 expression in A-431 ( Cat # L015V1 ).
Immunohistochemistry-Paraffin: ACTR2 Antibody (1B10-C4) [H00010097-M01] - Analysis of monoclonal antibody to ACTR2 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.
Sandwich ELISA: ACTR2 Antibody (1B10-C4) [H00010097-M01] - Detection limit for recombinant GST tagged ACTR2 is approximately 0.03ng/ml as a capture antibody.
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
CDC42 Antibody
(JJ086-04)
NBP2-67895
Flow Cytometry: CDC42 Antibody (JJ086-04) [NBP2-67895] - Analysis of Hela cells with CDC42 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunohistochemistry-Paraffin: CDC42 Antibody (JJ086-04) [NBP2-67895] - Analysis of paraffin-embedded human breast carcinoma tissue using anti-CDC42 antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: CDC42 Antibody (JJ086-04) [NBP2-67895] - Analysis of paraffin-embedded human pancreas tissue using anti-CDC42 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Angiopoietin-like
Protein 2/ANGPTL2 Ant ...
AF1444
Western blot shows lysates of mouse uterus tissue and MEF mouse embryonic feeder cells. PVDF membrane was probed with 2 µg/mL of Goat Anti-Mouse Angiopoietin‑like Protein 2/ANGPTL2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1444) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Angiopoietin‑like Protein 2/ANGPTL2 at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(2 Publications)
Species: Mu
Applications: IHC, WB
AICDA Antibody
NBP1-30955
Immunocytochemistry/Immunofluorescence: AICDA Antibody [NBP1-30955] - Analysis of methanol-fixed HeLa, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: AICDA Antibody [NBP1-30955] - Paraffin-embedded Cal27 xenograft, using antibody at 1:500 dilution.
Western Blot: AICDA Antibody [NBP1-30955] - Sample (30 ug of whole cell lysate) A: 293T 12% SDS PAGE, antibody diluted at 1:500.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
WIPF1/WIP Antibody
NBP3-15508
Immunohistochemistry-Paraffin: WIPF1/WIP Antibody [NBP3-15508] - Immunohistochemistry of paraffin-embedded human appendix using WIPF1/WIP antibody (NBP3-15508) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: WIPF1/WIP Antibody [NBP3-15508] - Immunohistochemistry of paraffin-embedded human esophageal using WIPF1/WIP antibody (NBP3-15508) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Western Blot: WIPF1/WIP Antibody [NBP3-15508] - Western blot analysis of extracts of various cell lines, using WIPF1/WIP Rabbit pAb (NBP3-15508) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
EGF [Unconjugated]
236-EG
1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
(26 Reviews)
(581 Publications)
Species: Hu
Applications: BA
WASF1/WAVE1
Antibody
NBP3-13180
Western Blot: WASF1/WAVE1 Antibody [NBP3-13180] - Various tissue extracts (50 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with WASF1/WAVE1 antibody (NBP3-13180) diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: WASF1/WAVE1 Antibody [NBP3-13180] - WASF1/WAVE1 antibody detects WASF1/WAVE1 protein at cytoplasm by immunofluorescent analysis. Sample: SK-N-SH cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: WASF1/WAVE1 protein stained by WASF1/WAVE1 antibody (NBP3-13180) diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Immunohistochemistry-Paraffin: WASF1/WAVE1 Antibody [NBP3-13180] - WASF1/WAVE1 antibody detects WASF1/WAVE1 protein at cytoplasm in mouse brain by immunohistochemical analysis. Sample: Paraffin-embedded mouse brain. WASF1/WAVE1 antibody (NBP3-13180) diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
EGFR Antibody
[Unconjugated]
AF231
EGFR was detected in immersion fixed frozen sections of human skin using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
EGFR was detected in immersion fixed A431 human epithelial carcinoma cell line using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for EGFR at approximately 175 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(13 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
SRGAP2 Antibody
NBP1-88830
Immunocytochemistry/Immunofluorescence: SRGAP2 Antibody [NBP1-88830] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SRGAP2 Antibody [NBP1-88830] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: SRGAP2 Antibody [NBP1-88830] - Staining of human skin shows moderate cytoplasmic positivity in keratinocytes.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western blot shows lysates of MDA‑MB‑468 human breast cancer cell line and HepG2 human hepatocellular carcinoma cell line untreated (-) or treated (+) with 50 μM pervanadate (PV) for 10 minutes. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Src (Y419) at approximately 56 - 61 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MBA‑MB‑468 human breast cancer cell line untreated (-) or treated (+) with 50 µM Pervanadate (PV) for 10 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Src (Y419) at approximately 64 kDa (as indicated) using 10 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human colon using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(6 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
Amphiphysin/AMPH
Antibody
NBP1-87561
Immunohistochemistry-Paraffin: Amphiphysin/AMPH Antibody [NBP1-87561] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: Amphiphysin/AMPH Antibody [NBP1-87561] - Staining of human tonsil shows low expression as expected.
Immunohistochemistry-Paraffin: Amphiphysin/AMPH Antibody [NBP1-87561] - Staining in human cerebral cortex and tonsil tissues using anti-AMPH antibody. Corresponding AMPH RNA-seq data are presented for the same tissues.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
VASP Antibody
(OTI4D6)
NBP2-00555
Flow Cytometry: VASP Antibody (OTI4D6) [NBP2-00555] - Analysis of Hela cells, using anti-VASP antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: VASP Antibody (OTI4D6) [NBP2-00555] - Analysis of Jurkat cells, using anti-VASP antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Western Blot: VASP Antibody (OTI4D6) [NBP2-00555] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY VASP (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-VASP.
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
WIPF3 Antibody
NBP1-84387
Immunohistochemistry-Paraffin: WIPF3 Antibody [NBP1-84387] - Staining of human hippocampus shows strong cytoplasmic positivity in neurons.
Species: Hu
Applications: IHC, IHC-P
BFAR Antibody
NB100-56094
Western Blot: BFAR Antibody [NB100-56094] - Analysis of BAR in cell lines and tissues. 25 ug of total protein was loaded per lane. BAR Recombinant protein (RP) was used as a positive control.
Immunohistochemistry-Paraffin: BFAR Antibody [NB100-56094] - Staining of tumor and normal Human tissues stained for BAR expression using this antibody at 1:2000. A. Pancreatic cancer. B. Normal pancreas. C. Esophageal cancer. D. Normal esophagus. Increased expression of BAR was detected in the tumor, compared to normal tissues. Hematoxylin-eosin counterstain.
Immunohistochemistry-Paraffin: BFAR Antibody [NB100-56094] - Staining of normal Human Brain. 1:2000. A) Cerebellum. B) Medulla. A1 and B1 are higher magnifications of A and B, respectively.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, IP, WB
SRGAP1 Antibody
(5D2)
H00057522-M03
Western Blot: SRGAP1 Antibody (5D2) [H00057522-M03] - SRGAP1 expression in IMR-32 ( Cat # L008V1 ).
Western Blot: SRGAP1 Antibody (5D2) [H00057522-M03] - SRGAP1 expression in NIH/3T3 ( Cat # L018V1 ).
ELISA: SRGAP1 Antibody (5D2) [H00057522-M03] - Detection limit for recombinant GST tagged SRGAP1 is approximately 0.1ng/ml as a capture antibody.
(2 Publications)
Species: Hu, Pm, Rt
Applications: ELISA, IHC, IHC-P, WB
SRGAP3 Antibody
NBP1-88831
Western Blot: SRGAP3 Antibody [NBP1-88831] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Cerebral Cortex
Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human pancreas shows low expression as expected.
(1 Publication)
Species: Hu, Rt
Applications: IHC, IHC-P, WB

Publications for FNBP1L Recombinant Protein Antigen (NBP2-49439PEP) (0)

There are no publications for FNBP1L Recombinant Protein Antigen (NBP2-49439PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FNBP1L Recombinant Protein Antigen (NBP2-49439PEP) (0)

There are no reviews for FNBP1L Recombinant Protein Antigen (NBP2-49439PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FNBP1L Recombinant Protein Antigen (NBP2-49439PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FNBP1L Products

Array NBP2-49439PEP

Bioinformatics Tool for FNBP1L Recombinant Protein Antigen (NBP2-49439PEP)

Discover related pathways, diseases and genes to FNBP1L Recombinant Protein Antigen (NBP2-49439PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FNBP1L Recombinant Protein Antigen (NBP2-49439PEP)

Discover more about diseases related to FNBP1L Recombinant Protein Antigen (NBP2-49439PEP).
 

Pathways for FNBP1L Recombinant Protein Antigen (NBP2-49439PEP)

View related products by pathway.

PTMs for FNBP1L Recombinant Protein Antigen (NBP2-49439PEP)

Learn more about PTMs related to FNBP1L Recombinant Protein Antigen (NBP2-49439PEP).

Blogs on FNBP1L

There are no specific blogs for FNBP1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
EGF [Unconjugated]
236-EG-200
EGFR was detected in immersion fixed frozen sections of human skin using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
EGFR Antibody [Unconjugated]
AF231

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FNBP1L Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol FNBP1L