FKBP12.6 Antibody (4H5-1B6)

Images

 
Western Blot: FKBP12.6 Antibody (4H5-1B6) [H00002281-M01] - Analysis of FKBP1B expression in transfected 293T cell line by FKBP1B monoclonal antibody (M01), clone 4H5-1B6.Lane 1: FKBP1B transfected lysate(11.8 KDa).Lane ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4H5-1B6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FKBP12.6 Antibody (4H5-1B6) Summary

Immunogen
FKBP1B (AAH02614, 1 a.a. - 80 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPLSPLPICPHPC
Specificity
FKBP1B - FK506 binding protein 1B, 12.6 kDa
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FKBP1B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FKBP12.6 Antibody (4H5-1B6)

  • 12.6 kDa FK506-binding protein
  • calstabin 2,12.6 kDa FKBP
  • EC 5.2.1.8
  • FK506 binding protein 1B, 12.6 kDa
  • FK506-binding protein 12.6
  • FK506-binding protein 1B (12.6 kD)
  • FK506-binding protein 1B
  • FKBP12.6
  • FKBP-12.6
  • FKBP12.6h-FKBP-12
  • FKBP1B
  • FKBP-1B
  • FKBP1L
  • FKBP9
  • Immunophilin FKBP12.6
  • OTK4
  • OTK4PPIase FKBP1B
  • peptidyl-prolyl cis-trans isomerase FKBP1B
  • PKBP1L
  • PPIase
  • rotamase

Background

The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is highly similar to the FK506-binding protein 1A. Its physiological role is thought to be in excitation-contraction coupling in cardiac muscle. There are two alternatively spliced transcript variants of this gene encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-57062
Species: Hu
Applications: WB, ICC/IF
NBP1-90091
Species: Hu
Applications: IHC, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
MAB3777
Species: Hu, Mu, Rt
Applications: WB
AF6387
Species: Hu
Applications: WB
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB300-543
Species: Hu, Mu, Rt, Am, Bv, Ca, Ft, Fi, Pm, Rb, Sh
Applications: WB, B/N, IHC, IHC-Fr, IHC-P, IP, IF
MAB7670
Species: Hu
Applications: WB, ICC
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P, IP
MAB2294
Species: Hu, Mu
Applications: WB, IHC, IP
NBP1-85543
Species: Hu
Applications: WB, IHC, IHC-P
AF4094
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB120-3562
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-98474
Species: Hu
Applications: WB
NBP1-19117
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
H00002281-M01
Species: Hu
Applications: WB, ELISA

Publications for FKBP12.6 Antibody (H00002281-M01) (0)

There are no publications for FKBP12.6 Antibody (H00002281-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FKBP12.6 Antibody (H00002281-M01) (0)

There are no reviews for FKBP12.6 Antibody (H00002281-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FKBP12.6 Antibody (H00002281-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FKBP12.6 Products

Bioinformatics Tool for FKBP12.6 Antibody (H00002281-M01)

Discover related pathways, diseases and genes to FKBP12.6 Antibody (H00002281-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FKBP12.6 Antibody (H00002281-M01)

Discover more about diseases related to FKBP12.6 Antibody (H00002281-M01).
 

Pathways for FKBP12.6 Antibody (H00002281-M01)

View related products by pathway.

Research Areas for FKBP12.6 Antibody (H00002281-M01)

Find related products by research area.

Blogs on FKBP12.6

There are no specific blogs for FKBP12.6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FKBP12.6 Antibody (4H5-1B6) and receive a gift card or discount.

Bioinformatics

Gene Symbol FKBP1B
Entrez
OMIM
Uniprot