FITM1 Antibody

Images

 
Western Blot: FITM1 Antibody [NBP1-84679] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: FITM1 Antibody [NBP1-84679] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts and leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FITM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RRVAVTARHLSRLVVGAAVWRGAGRAFLLIEDLTGSCFEPLPQGLLLHELPDRRSCLAAGHQWRGYTVSSHTF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FITM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FITM1 Protein (NBP1-84679PEP)
Publications
Read Publication using NBP1-84679.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FITM1 Antibody

  • fat storage-inducing transmembrane protein 1
  • fat-inducing transcript 1
  • FIT1Fat-inducing protein 1
  • MGC46490

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31415
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76498
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
NB100-1028
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, ICC
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP1-86658
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
NB100-56537
Species: Hu, Mu
Applications: WB, ChIP, IP
NLS1049
Species: Hu, Eq, Mk, Pm
Applications: IHC-P, ICC

Publications for FITM1 Antibody (NBP1-84679)(1)

Reviews for FITM1 Antibody (NBP1-84679) (0)

There are no reviews for FITM1 Antibody (NBP1-84679). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FITM1 Antibody (NBP1-84679) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FITM1 Products

Bioinformatics Tool for FITM1 Antibody (NBP1-84679)

Discover related pathways, diseases and genes to FITM1 Antibody (NBP1-84679). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FITM1 Antibody (NBP1-84679)

Discover more about diseases related to FITM1 Antibody (NBP1-84679).
 

Pathways for FITM1 Antibody (NBP1-84679)

View related products by pathway.

PTMs for FITM1 Antibody (NBP1-84679)

Learn more about PTMs related to FITM1 Antibody (NBP1-84679).

Blogs on FITM1

There are no specific blogs for FITM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FITM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FITM1