FHDC1 Recombinant Protein Antigen

Images

 
There are currently no images for FHDC1 Protein (NBP1-93579PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FHDC1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FHDC1.

Source: E.coli

Amino Acid Sequence: EHELVTGLAQFNLQGSQGMEETSQLTLSDFSPMELESVGHRGPQSLSASSSSLTPMGRDALGSLSPALEDGKAAPDEPGSAALGSVGSSDPENKDPRPLFCISDTTDCSLTLDCSEGTDSRPRGGDPEEGGEGDGSMSSGV

Protein/Peptide Type
Recombinant Protein Antigen
Gene
FHDC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-93579.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FHDC1 Recombinant Protein Antigen

  • FH2 domain containing 1
  • FH2 domain-containing protein 1
  • KIAA1727

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24724
Species: Hu, Mu, Rt, Bv, Ca, Eq, Pm
Applications: WB
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-24536
Species: Hu, Mu
Applications: WB
NBP1-83900
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-94174
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88460
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00081624-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB600-230
Species: Hu
Applications: WB
NBP2-24615
Species: Hu
Applications: WB, IHC-P
NBP1-85217
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24623
Species: Hu, Mu, Rt, Bv, Ca, Eq
Applications: WB
NBP2-24748
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86739
Species: Hu
Applications: IHC, IHC-P
NB100-56883
Species: Hu
Applications: IHC, IHC-P
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87933
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-14021
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15971
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FHDC1 Protein (NBP1-93579PEP) (0)

There are no publications for FHDC1 Protein (NBP1-93579PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FHDC1 Protein (NBP1-93579PEP) (0)

There are no reviews for FHDC1 Protein (NBP1-93579PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for FHDC1 Protein (NBP1-93579PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FHDC1 Products

FHDC1 NBP1-93579PEP

Bioinformatics Tool for FHDC1 Protein (NBP1-93579PEP)

Discover related pathways, diseases and genes to FHDC1 Protein (NBP1-93579PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FHDC1 Protein (NBP1-93579PEP)

Discover more about diseases related to FHDC1 Protein (NBP1-93579PEP).
 

Pathways for FHDC1 Protein (NBP1-93579PEP)

View related products by pathway.

PTMs for FHDC1 Protein (NBP1-93579PEP)

Learn more about PTMs related to FHDC1 Protein (NBP1-93579PEP).

Blogs on FHDC1

There are no specific blogs for FHDC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Gremlin 1 Antibody
NB100-56883
FHDC1 Antibody
NBP1-93579
FMNL2 Antibody
NBP2-24748
FMNL2 Antibody
NBP2-24748
FMNL2 Antibody
NBP2-24748
FMN2 Antibody
NBP2-24615
FMN2 Antibody
NBP2-24615

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FHDC1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FHDC1