Home » FBXW2 » FBXW2 Proteins » FBXW2 Recombinant Protein Antigen

FBXW2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for FBXW2 Protein (NBP2-39089PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

FBXW2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FBXW2.

Source: E.coli

Amino Acid Sequence: LYIMDLRTESLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSIHLVLWKEHG
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FBXW2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-39089.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for FBXW2 Recombinant Protein Antigen

  • F-box and WD repeat domain containing 2
  • F-box and WD-40 domain protein 2
  • F-box and WD-40 domain-containing protein 2
  • F-box/WD repeat-containing protein 2
  • FBW2Fwd2
  • FWD2
  • Md6
  • MGC117371
  • Protein MD6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SCF/c-kit Ligand
[Unconjugated]
255-SC/CF
1 μg/lane of Recombinant Human SCF/c-kit Ligand was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 19 kDa.
Recombinant Human SCF/c-kit Ligand (Catalog # 255-SC/CF) stimulates cell proliferation of the TF-1 human erythroleukemic cell line. The ED50 for this effect is 1-5 ng/mL.
(169 Publications)
Species: Hu
Applications: BA
GCM1 Antibody
(2E11)
H00008521-M05
Immunocytochemistry/Immunofluorescence: GCM1 Antibody (2E11) [H00008521-M05] - Analysis of monoclonal antibody to GCM1 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: GCM1 Antibody (2E11) [H00008521-M05] - Analysis of monoclonal antibody to GCM1 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 1.7 ug/ml
Western Blot: GCM1 Antibody (2E11) [H00008521-M05] - Analysis of GCM1 expression in FHs 173 WE.
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Cullin 1 Antibody
(JM72-30)
NBP2-75458
Flow Cytometry: Cullin 1 Antibody (JM72-30) [NBP2-75458] - Analysis of Hela cells with Cullin 1 antibody at 1/100 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black).
Immunohistochemistry-Paraffin: Cullin 1 Antibody (JM72-30) [NBP2-75458] - Analysis of paraffin-embedded human stomach cancer tissue using anti-Cullin 1 antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: Cullin 1 Antibody (JM72-30) [NBP2-75458] - Analysis of paraffin-embedded mouse oviduct tissue using anti-Cullin 1 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, IP, WB
Skp1 Antibody
(JM27-37)
NBP2-67147
Flow Cytometry: Skp1 Antibody (JM27-37) [NBP2-67147] - Analysis of Hela cells with Skp1 antibody at 1/100 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black).
Immunocytochemistry/Immunofluorescence: Skp1 Antibody (JM27-37) [NBP2-67147] - Staining Skp1 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Skp1 Antibody (JM27-37) [NBP2-67147] - Staining Skp1 in SH-SY5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
beta-TrCP1/BTRC
Antibody (4C5D8) - BS ...
NBP2-61712
ELISA: beta-TrCP1/BTRC Antibody (4C5D8) [NBP2-61712] - Black line: Control Antigen (100 ng);Purple line: Antigen (10ng); Blue line: Antigen (50 ng); Red line:Antigen (100 ng)
Flow Cytometry: beta-TrCP1/BTRC Antibody (4C5D8) [NBP2-61712] - Analysis of Hela cells using BTRC mouse mAb (green) and negative control (red).
Immunohistochemistry: beta-TrCP1/BTRC Antibody (4C5D8) [NBP2-61712] - Analysis of paraffin-embedded esophageal cancer tissues using BTRC mouse mAb with DAB staining.
Species: Hu
Applications: ELISA, Flow, IHC, IHC-P, WB

beta-Galactosidase-1/G ...
NBP2-45731
Western Blot: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of extracts (35ug) from 9 different cell lines by using anti-GLB1 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunohistochemistry: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of Carcinoma of Human pancreas tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of Human liver tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
(6 Publications)
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
MyoD Antibody
(5.8A) - BSA Free
NB100-56511
Immunocytochemistry/Immunofluorescence: MyoD Antibody (5.8A) [NB100-56511] - Cell Lines Tested: mouse skeletal muscle-derived primary cell population Test Sample Preparation: mouse skeletal muscle digested by collagenase type 2 System: Super Sensitive High Resolution Confocal Laser Microscope (LSM880 with Airyscan) Excitation Wavelength: 488nm Emission Filter: 562 nm. Image using the DyLight 488 form of this antibody. ICC/IF image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: MyoD Antibody (5.8A) [NB100-56511] - Human myoblasts were stained with MyoD1 antibody, diluted 1:200. ICC/IF image submitted by a verified customer review.
Western Blot: MyoD Antibody (5.8A) [NB100-56511] - Insuline-like growth factor (IGF1) antagonized the effects of miR-106a-5p on myogenic differentiation in C2C12. All data were collected from C2C12 myotubes 5 d post differentiation. Western-blot analysis of myogenic regulatory factors (MyoD, MyoG, MyHC) in cells; (H) The statistical results of Figure 3G. Data were presented as mean +/- SEM. n = 3 per group. * p < 0.05, ** p < 0.01. Image collected and cropped by CiteAb from the following publication (https://www.mdpi.com/2073-4425/9/7/333/htm) licensed under a CC-BY licence. anti-MyoG (catalog# NB100-56510)
(2 Reviews)
(23 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
Recombinant Human
CAC1 GST (N-Term) Pro ...
H00143384-P01
SDS-Page: Recombinant Human CAC1 Protein [H00143384-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
FBXO4 Antibody
NBP1-52158
Immunohistochemistry-Paraffin: FBXO4 Antibody [NBP1-52158] - 2.5ug/ml staining of paraffin embedded Human Tonsil. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
MYF-5 Antibody
(OTI2G5)
NBP2-44245
Western Blot: MYF-5 Antibody (OTI2G5) [NBP2-44245] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY MYF5 , (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-MYF5
Immunohistochemistry-Paraffin: MYF-5 Antibody (OTI2G5) [NBP2-44245] - Human breast tissue within the normal limits using anti-MYF5 mouse monoclonal antibody. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Immunohistochemistry-Paraffin: MYF-5 Antibody (OTI2G5) [NBP2-44245] - Carcinoma of Human kidney tissue using anti-MYF5 mouse monoclonal antibody. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Dihydrolipoamide
Dehydrogenase/DLD Ant ...
NBP1-31302
Immunocytochemistry/Immunofluorescence: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: DLD protein stained by DLD antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - Sample(30 ug of whole cell lysate) A:293T 10% SDS PAGE, antibody diluted at 1:1000.
Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - Wild-type (WT) and DLD knockout (KO) HeLa cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with DLD antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
EMI1 Antibody
(JG35-83)
NBP2-76833
Immunohistochemistry: EMI1 Antibody (JG35-83) [NBP2-76833] - Immunohistochemical analysis of paraffin-embedded human colon cancer tissue using anti-Emi1 antibody. Counter stained with hematoxylin.
Immunohistochemistry: EMI1 Antibody (JG35-83) [NBP2-76833] - Immunohistochemical analysis of paraffin-embedded human kidney tissue using anti-Emi1 antibody. Counter stained with hematoxylin.
Immunohistochemistry: EMI1 Antibody (JG35-83) [NBP2-76833] - Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue using anti-Emi1 antibody. Counter stained with hematoxylin.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ALDH9A1 Antibody
NBP1-89150
Western Blot: ALDH9A1 Antibody [NBP1-89150] - Analysis in human cell line TD47D.
Western Blot: ALDH9A1 Antibody [NBP1-89150] - Analysis in rat cell line NBT-II.
Immunohistochemistry-Paraffin: ALDH9A1 Antibody [NBP1-89150] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
(3 Publications)
Species: Hu, Rt
Applications: IHC, IHC-P, WB
FBXL3 Antibody
(1A3)
H00026224-M03
Sandwich ELISA: FBXL3 Antibody (1A3) [H00026224-M03] - Detection limit for recombinant GST tagged FBXL3 is 0.1 ng/ml as a capture antibody.
Western Blot: FBXL3 Antibody (1A3) [H00026224-M03] - Analysis of FBXL3 expression in HeLa (Cat # L013V1).
Western Blot: FBXL3 Antibody (1A3) [H00026224-M03] - Analysis of FBXL3 expression in Raw 264.7 (Cat # L024V1).
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
ILT6/CD85e/LILRA3
Antibody
NBP1-98549
Western Blot: ILT6/CD85e/LILRA3 Antibody [NBP1-98549] - Human OVCAR-3 Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide. Primary Antibody Concentration: 1.0 ug/mL. Peptide Concentration: 2.0 ug/mL lysate. Quantity: 25 ug/lane.
Western Blot: ILT6/CD85e/LILRA3 Antibody [NBP1-98549] - Antibody Dilution: 1.0ug/ml Sample Tissue: Human Kidney.
(1 Review)
Species: Hu
Applications: WB
FBXW7/Cdc4 Antibody
NBP1-59631
Immunohistochemistry: FBXW7/Cdc4 Antibody [NBP1-59631] - Kidney
Immunohistochemistry: FBXW7/Cdc4 Antibody [NBP1-59631] - Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Cytoplasmic in cell bodies and processes of pinealocytes Primary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
Western Blot: FBXW7/Cdc4 Antibody [NBP1-59631] - Sample Type: Human Fetal Heart Antibody Dilution: 1.0 ug/ml
(1 Review)
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
FBPase 1 Antibody
NBP1-84721
Immunohistochemistry-Paraffin: FBPase 1 Antibody [NBP1-84721] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: FBPase 1 Antibody [NBP1-84721] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: FBPase 1 Antibody [NBP1-84721] - Staining of human liver shows moderate to strong cytoplasmic positivity in hepatocytes.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
GCM2 Antibody
NBP2-98880
Immunocytochemistry/Immunofluorescence: GCM2 Antibody [NBP2-98880] - Immunofluorescence staining of GCM2 in A431 cells. Cells were fixed with 4% PFA, permeabilzed with 0.3% Triton X-100 in PBS, blocked with 10% serum, and incubated with rabbit anti-human GCM2 polyclonal antibody (1:5000) at 4C overnight. Then cells were stained with the Alexa Fluor(R)488-conjugated Goat Anti-rabbit IgG secondary antibody (green).Positive staining was localized to nucleus.
Western Blot: GCM2 Antibody [NBP2-98880] - Lane A: A431 Whole Cell Lysate Lysates/proteins at 30 ug per lane.Secondary Goat Anti- Rabbit IgG H&L (Dylight 800) at 1/10000 dilution.Developed using the Odyssey technique. Performed under reducing conditions.Predicted band size:56 kDa Observed band size:56 kDa
Species: Hu
Applications: ELISA, ICC/IF, WB

Publications for FBXW2 Protein (NBP2-39089PEP) (0)

There are no publications for FBXW2 Protein (NBP2-39089PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXW2 Protein (NBP2-39089PEP) (0)

There are no reviews for FBXW2 Protein (NBP2-39089PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FBXW2 Protein (NBP2-39089PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FBXW2 Products

Bioinformatics Tool for FBXW2 Protein (NBP2-39089PEP)

Discover related pathways, diseases and genes to FBXW2 Protein (NBP2-39089PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXW2 Protein (NBP2-39089PEP)

Discover more about diseases related to FBXW2 Protein (NBP2-39089PEP).
 

Pathways for FBXW2 Protein (NBP2-39089PEP)

View related products by pathway.

PTMs for FBXW2 Protein (NBP2-39089PEP)

Learn more about PTMs related to FBXW2 Protein (NBP2-39089PEP).

Blogs on FBXW2

There are no specific blogs for FBXW2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Immunocytochemistry/Immunofluorescence: MyoD Antibody (5.8A) [NB100-56511] - Cell Lines Tested: mouse skeletal muscle-derived primary cell population Test Sample Preparation: mouse skeletal muscle digested by collagenase type 2 System: Super Sensitive High Resolution Confocal Laser Microscope (LSM880 with Airyscan) Excitation Wavelength: 488nm Emission Filter: 562 nm. Image using the DyLight 488 form of this antibody. ICC/IF image submitted by a verified customer review.
MyoD Antibody (5.8A) - BSA Free
NB100-56511

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FBXW2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol FBXW2