FBXW2 Recombinant Protein Antigen

Images

 
There are currently no images for FBXW2 Protein (NBP2-39089PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FBXW2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FBXW2.

Source: E. coli

Amino Acid Sequence: LYIMDLRTESLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSIHLVLWKEHG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FBXW2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-39089.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FBXW2 Recombinant Protein Antigen

  • F-box and WD repeat domain containing 2
  • F-box and WD-40 domain protein 2
  • F-box and WD-40 domain-containing protein 2
  • F-box/WD repeat-containing protein 2
  • FBW2Fwd2
  • FWD2
  • Md6
  • MGC117371
  • Protein MD6

Background

F-box proteins are an expanding family of eukaryotic proteins characterized by an approximately 40 amino acid motif, the F box. Some F-box proteins have been shown to be critical for the ubiquitin-mediated degradation of cellular regulatory proteins. In fact, F-box proteins are one of the four subunits of ubiquitin protein ligases, called SCFs. SCF ligases bring ubiquitin conjugating enzymes to substrates that are specifically recruited by the different F-box proteins. A large family of mammalian F-box proteins has recently been identified and classified into three groups based on the presence of either the WD-40 repeats, the leucine-rich repeats, or the presence or absence of other protein-protein interacting domains. The FBXW2 gene product, the second identified member of the F-box gene family, contains multiple WD-40 repeats.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

255-SC
Species: Hu
Applications: BA
H00008521-M05
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP3-16092
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-20380
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-61712
Species: Hu
Applications: ELISA, Flow, IHC,  IHC-P, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC,  IHC-P, WB
NB100-56511
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, WB
H00143384-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-52158
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP2-44245
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP1-84850
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC,  IHC-P, WB
H00026224-M03
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
NBP1-59631
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-15423
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-46252
Species: Hu, Mu
Applications: ELISA, WB

Publications for FBXW2 Protein (NBP2-39089PEP) (0)

There are no publications for FBXW2 Protein (NBP2-39089PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXW2 Protein (NBP2-39089PEP) (0)

There are no reviews for FBXW2 Protein (NBP2-39089PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FBXW2 Protein (NBP2-39089PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FBXW2 Products

Blogs on FBXW2

There are no specific blogs for FBXW2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FBXW2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXW2