FBXW12 Recombinant Protein Antigen

Images

 
There are currently no images for FBXW12 Protein (NBP2-30769PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FBXW12 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FBXW12.

Source: E. coli

Amino Acid Sequence: SPVQEFHFSNLVTLPQMHLAITMDWKKTIKVWNCQDRDALAVLPMPQPCYCMEAYLTKDGPFLMVGDAAGDIYTFTLPGLRDVSKVTAFQY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FBXW12
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-30769.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FBXW12 Recombinant Protein Antigen

  • F-box and WD repeat domain containing 12
  • F-box and WD-40 domain-containing protein 12
  • F-box- and WD40-repeat-containing protein
  • F-box only protein 35MGC120386
  • F-box/WD repeat-containing protein 12
  • Fbw12
  • FBW12MGC120387
  • FBXO12FBXO35F-box and WD-40 domain protein 12
  • MGC120385

Background

FBXW12, also known as F-box/WD repeat-containing protein 12, has 3 isoforms, a 464 amino acid isoform that is 53 kDa, a 394 amino acid isoform that is 45 kDa and a 445 amino acid isoform that is 51 kDa; ubiquitously expressed, acts as a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. Little is currently known about this protein disease involvement or interaction with other proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00055294-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NBP1-84715
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-1300
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP2-20380
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-14013
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-16092
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
255-SC
Species: Hu
Applications: BA
NBP2-61712
Species: Hu
Applications: ELISA, Flow, IHC,  IHC-P, WB
NBP2-20113
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-30769PEP
Species: Hu
Applications: AC

Publications for FBXW12 Protein (NBP2-30769PEP) (0)

There are no publications for FBXW12 Protein (NBP2-30769PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXW12 Protein (NBP2-30769PEP) (0)

There are no reviews for FBXW12 Protein (NBP2-30769PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FBXW12 Protein (NBP2-30769PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FBXW12 Products

Array NBP2-30769PEP

Blogs on FBXW12

There are no specific blogs for FBXW12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FBXW12 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXW12