FBXO27 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FBXO27 Antibody [NBP2-56468] - Staining of human cell line PC-3 shows localization to nucleoplasm. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FBXO27 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ARSCQSPARNARPCPLGRFCARRPIGRNLIRNPCGQEGLRKWMVQHGGDG
Specificity
Specificity of human FBXO27 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBXO27
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for FBXO27 Antibody

  • Fbg5
  • FBG5FBX27
  • F-box only protein 27
  • F-box protein 27
  • F-box protein FBG5
  • F-box/G-domain protein 5
  • Fbx27

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-65253
Species: Hu
NBP2-16451
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37539
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-466
Species: Hu, Mu, Rt
Applications: WB
NBP1-84728
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-55046
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB
MAB6609
Species: Hu, Mu
Applications: WB, IHC
NB100-1591
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-75643
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for FBXO27 Antibody (NBP2-56468) (0)

There are no publications for FBXO27 Antibody (NBP2-56468).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXO27 Antibody (NBP2-56468) (0)

There are no reviews for FBXO27 Antibody (NBP2-56468). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FBXO27 Antibody (NBP2-56468) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FBXO27 Products

Bioinformatics Tool for FBXO27 Antibody (NBP2-56468)

Discover related pathways, diseases and genes to FBXO27 Antibody (NBP2-56468). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for FBXO27 Antibody (NBP2-56468)

View related products by pathway.

Blogs on FBXO27

There are no specific blogs for FBXO27, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FBXO27 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXO27