Recombinant Human FBXL3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FBXL3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human FBXL3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKRGGRDSDRNSSEEGTAEKSKKLRTTNEHSQTCDWGNLLQDIILQVFKYLPLLDRAHASQVCRNWNQVFHMPDLWRCFEFELNQPATSYLKATHPELIK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
FBXL3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FBXL3 Protein

  • FBL3AF-box and leucine-rich repeat protein 3AF-box protein Fbl3a
  • FBL3F-box/LRR-repeat protein 3
  • F-box and leucine-rich repeat protein 3
  • F-box/LRR-repeat protein 3A
  • FBXL3A

Background

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats and is localized in the nucleus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7675
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-125
Species: Hu
Applications: WB, ICC/IF
NBP2-16450
Species: Hu
Applications: WB, ICC/IF
AF3764
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-84850
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1300
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
AF165
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-00749
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NB100-126
Species: Hu, Mu
Applications: WB, ChIP
NBP1-59068
Species: Hu
Applications: WB
H00026224-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for FBXL3 Partial Recombinant Protein (H00026224-Q01) (0)

There are no publications for FBXL3 Partial Recombinant Protein (H00026224-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXL3 Partial Recombinant Protein (H00026224-Q01) (0)

There are no reviews for FBXL3 Partial Recombinant Protein (H00026224-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FBXL3 Partial Recombinant Protein (H00026224-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FBXL3 Products

Bioinformatics Tool for FBXL3 Partial Recombinant Protein (H00026224-Q01)

Discover related pathways, diseases and genes to FBXL3 Partial Recombinant Protein (H00026224-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXL3 Partial Recombinant Protein (H00026224-Q01)

Discover more about diseases related to FBXL3 Partial Recombinant Protein (H00026224-Q01).
 

Pathways for FBXL3 Partial Recombinant Protein (H00026224-Q01)

View related products by pathway.

PTMs for FBXL3 Partial Recombinant Protein (H00026224-Q01)

Learn more about PTMs related to FBXL3 Partial Recombinant Protein (H00026224-Q01).

Blogs on FBXL3

There are no specific blogs for FBXL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF
FBXL3 Antibody (1A3)
H00026224-M03

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FBXL3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXL3