FbxL12 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FbxL12 Antibody [NBP2-58272] - Staining of human cell line U-2 OS shows localization to mitochondria.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FbxL12 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VLGGTYRVTETGLDAGLQELSYLQRLEVLGCTLSADSTLLAISRHLRDVRKIRLTVRGLSAPGLAVLEGMPALESLCLQGPLVTPEMPSPTEILSSCLTMPKLRVLELQGLGWEGQEAEKILCKGLPHCMVIVRAC
Specificity
Specificity of human FbxL12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBXL12
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FbxL12 Recombinant Protein Antigen (NBP2-58272PEP)

Reactivity Notes

Rat 88%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for FbxL12 Antibody

  • Fbl12
  • F-box and leucine-rich repeat protein 12FLJ20188
  • F-box protein FBL12
  • F-box/LRR-repeat protein 12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2269
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, KD
H00011151-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-83180
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-94462
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
AF2940
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
NBP2-56316
Species: Hu
Applications: IHC, IHC-P
H00010518-A01
Species: Hu, Ze
Applications: WB, ELISA
NBP2-58272
Species: Hu, Mu
Applications: ICC/IF

Publications for FbxL12 Antibody (NBP2-58272) (0)

There are no publications for FbxL12 Antibody (NBP2-58272).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FbxL12 Antibody (NBP2-58272) (0)

There are no reviews for FbxL12 Antibody (NBP2-58272). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FbxL12 Antibody (NBP2-58272) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FbxL12 Products

Bioinformatics Tool for FbxL12 Antibody (NBP2-58272)

Discover related pathways, diseases and genes to FbxL12 Antibody (NBP2-58272). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FbxL12 Antibody (NBP2-58272)

Discover more about diseases related to FbxL12 Antibody (NBP2-58272).
 

Pathways for FbxL12 Antibody (NBP2-58272)

View related products by pathway.

Blogs on FbxL12

There are no specific blogs for FbxL12, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FbxL12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXL12