FAM92B Antibody

Immunohistochemistry-Paraffin: FAM92B Antibody [NBP1-81895] - Staining in human fallopian tube and prostate tissues using anti-FAM92B antibody. Corresponding FAM92B RNA-seq data are presented for the same tissues.

Western Blot: FAM92B Antibody [NBP1-81895] - Analysis in control (vector only transfected HEK293T lysate) and FAM92B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: FAM92B Antibody [NBP1-81895] - Staining of human fallopian tube shows high expression.

Immunohistochemistry-Paraffin: FAM92B Antibody [NBP1-81895] - Staining of human prostate shows low expression as expected.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

FAM92B Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TLEKYDLERDLLDFRAKMQGVYGHYDTRLLANTSPPPSVLQSLASQGTLQVQLSRANEDPEHPHANHGRFSLCEWVVKGQPAHCVCGQGG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FAM92B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  FAM92B Protein (NBP1-81895PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FAM92B Antibody

• family with sequence similarity 92, member B
• FLJ44299
• hypothetical protein LOC339145
• MGC138149

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FAM92B