FAM92B Antibody

Images

 
Western Blot: FAM92B Antibody [NBP1-56428] - Hela cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM92B Antibody Summary

Immunogen
Synthetic peptides corresponding to FAM92B(family with sequence similarity 92, member B) The peptide sequence was selected from the N terminal of FAM92B. Peptide sequence FAEDLAKVQDYRQAQVERLETKVVNPLKLYGAQIKQTRAEIKKFKHVQNH.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM92B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against FAM92B and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FAM92B Antibody

  • family with sequence similarity 92, member B
  • FLJ44299
  • hypothetical protein LOC339145
  • MGC138149

Background

The specific function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-61666
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF4940
Species: Hu, Mu
Applications: ICC
NB600-1147
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, IHC-P, Flow-CS
NB110-60928
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, EM, IHC, IHC-P
AF7109
Species: Mu
Applications: WB, IHC
NBP1-76377
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-56428
Species: Hu
Applications: WB

Publications for FAM92B Antibody (NBP1-56428) (0)

There are no publications for FAM92B Antibody (NBP1-56428).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM92B Antibody (NBP1-56428) (0)

There are no reviews for FAM92B Antibody (NBP1-56428). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM92B Antibody (NBP1-56428) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM92B Products

Bioinformatics Tool for FAM92B Antibody (NBP1-56428)

Discover related pathways, diseases and genes to FAM92B Antibody (NBP1-56428). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM92B Antibody (NBP1-56428)

Discover more about diseases related to FAM92B Antibody (NBP1-56428).
 

Pathways for FAM92B Antibody (NBP1-56428)

View related products by pathway.

Blogs on FAM92B

There are no specific blogs for FAM92B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM92B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM92B
Uniprot