FAM46D Antibody

Images

 
Western Blot: FAM46D Antibody [NBP1-56728] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM46D Antibody Summary

Immunogen
Synthetic peptides corresponding to FAM46D(family with sequence similarity 46, member D) The peptide sequence was selected from the middle region of FAM46D. Peptide sequence LPNTQKVTCFYQPAPYFAAEARYPIYVIPEPPPVSFQPYHPLHFRGSNGM. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM46D
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against FAM46D and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FAM46D Antibody

  • cancer/testis antigen 112
  • CT1.26
  • CT112
  • family with sequence similarity 46, member D
  • hypothetical protein LOC169966
  • MGC26999

Background

The specific function of FAM46D is not yet known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-93797
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for FAM46D Antibody (NBP1-56728) (0)

There are no publications for FAM46D Antibody (NBP1-56728).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM46D Antibody (NBP1-56728) (0)

There are no reviews for FAM46D Antibody (NBP1-56728). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM46D Antibody (NBP1-56728) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FAM46D Products

Bioinformatics Tool for FAM46D Antibody (NBP1-56728)

Discover related pathways, diseases and genes to FAM46D Antibody (NBP1-56728). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM46D Antibody (NBP1-56728)

Discover more about diseases related to FAM46D Antibody (NBP1-56728).

Blogs on FAM46D

There are no specific blogs for FAM46D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM46D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM46D
Uniprot