![Western Blot: FAM32A Antibody [NBP2-30704] - Analysis in human cell line PC-3.](http://images.novusbio.com/fullsize2/FAM32A-Antibody-Western-Blot-NBP2-30704-img0008.jpg "Western Blot: FAM32A Antibody [NBP2-30704] - Analysis in human cell line PC-3.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RLDKRTPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK |
| Predicted Species | Mouse (98%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FAM32A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
-Flow-Cytometry-NB200-103-img0006.jpg)
-Flow-Cytometry-NB200-103-img0007.jpg)
-Flow-(Intracellular)-NB200-103-img0003.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: FAM32A Antibody [NBP2-30704] - Staining of human cell line A-431 shows localization to nucleus & nucleoli. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/FAM32A-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30704-img0004.jpg "Immunocytochemistry/Immunofluorescence: FAM32A Antibody [NBP2-30704] - Staining of human cell line A-431 shows localization to nucleus & nucleoli. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: FAM32A Antibody [NBP2-30704] - Staining of human skin shows weak positivity in nucleoli in squamous epithelial cells.](http://images.novusbio.com/fullsize2/FAM32A-Antibody-Immunohistochemistry-Paraffin-NBP2-30704-img0007.jpg "Immunohistochemistry-Paraffin: FAM32A Antibody [NBP2-30704] - Staining of human skin shows weak positivity in nucleoli in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: FAM32A Antibody [NBP2-30704] - Staining of human gastrointestinal shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize2/FAM32A-Antibody-Immunohistochemistry-Paraffin-NBP2-30704-img0005.jpg "Immunohistochemistry-Paraffin: FAM32A Antibody [NBP2-30704] - Staining of human gastrointestinal shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: FAM32A Antibody [NBP2-30704] - Staining of human pancreas shows weak positivity in nucleoli in exocrine glandular cells.](http://images.novusbio.com/fullsize2/FAM32A-Antibody-Immunohistochemistry-Paraffin-NBP2-30704-img0006.jpg "Immunohistochemistry-Paraffin: FAM32A Antibody [NBP2-30704] - Staining of human pancreas shows weak positivity in nucleoli in exocrine glandular cells.")
-Immunohistochemistry-Paraffin-NBP2-36489-img0001.jpg)
-Immunohistochemistry-Paraffin-NBP2-36489-img0002.jpg)
-Immunohistochemistry-Paraffin-NBP2-36489-img0003.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")