FAM32A Antibody

Images

 
Western Blot: FAM32A Antibody [NBP2-30704] - Analysis in human cell line PC-3.
Immunocytochemistry/ Immunofluorescence: FAM32A Antibody [NBP2-30704] - Staining of human cell line A-431 shows localization to nucleus & nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: FAM32A Antibody [NBP2-30704] - Staining of human skin shows weak positivity in nucleoli in squamous epithelial cells.
Immunohistochemistry-Paraffin: FAM32A Antibody [NBP2-30704] - Staining of human gastrointestinal shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: FAM32A Antibody [NBP2-30704] - Staining of human pancreas shows weak positivity in nucleoli in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM32A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RLDKRTPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM32A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM32A Protein (NBP2-30704PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM32A Antibody

  • DKFZP586O0120
  • family with sequence similarity 32, member A
  • hypothetical protein LOC26017

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-36489
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-77196
Species: Ec, Hu
Applications: ELISA, ICC, ICC/IF, IF, IM, IP, PAGE, WB
NB100-56080
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Publications for FAM32A Antibody (NBP2-30704) (0)

There are no publications for FAM32A Antibody (NBP2-30704).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM32A Antibody (NBP2-30704) (0)

There are no reviews for FAM32A Antibody (NBP2-30704). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FAM32A Antibody (NBP2-30704) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM32A Products

Bioinformatics Tool for FAM32A Antibody (NBP2-30704)

Discover related pathways, diseases and genes to FAM32A Antibody (NBP2-30704). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM32A

There are no specific blogs for FAM32A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM32A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM32A
Uniprot