Reactivity | Mu, RtSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Format | Azide and BSA Free |
Description | Novus Biologicals Rabbit FAM155B Antibody - Azide and BSA Free (NBP3-04074) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 400-472 of human FAM155B (NP_056501.2). HYHPHHDPPGRVSNKPALLPVSGGSRLSPSRIRLCVLVLMLLHTVVSFSSNQGGGGLGLETLPALEEGLTREE |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | NALF2 |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.3), 50% glycerol |
Preservative | 0.01% Thimerosal |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for FAM155B Antibody (NBP3-04074)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | NALF2 |