Recombinant Human FAM13A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FAM13A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-202 of Human FAM13A1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGAGALAICQSKAAVRLKEDMKKIVAVPLNEQKDFTYQKLFGVSLQELERQGLTENGIPAVVWNIVEYLTQHGLTQEGLFRVNGNVKVVEQLRLKFESGVPVELGKDGDVCSAASLLKLFLRELPDSLITSALQPRFIQLFQDGRNDVQESSLRDLIKELPDTHYCLLKYLCQFLTKVAKHHVQNRMNVHNLATVFGPNCFQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
FAM13A
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FAM13A Protein

  • ARHGAP48
  • FAM13A1
  • FAM13A1_v2 protein
  • family with sequence similarity 13, member A
  • KIAA0914
  • member A1
  • MGC105131

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00064399-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NB100-1798
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, GS
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-55967
Species: Hu
Applications: ICC/IF
NBP1-87534
Species: Hu, Mu
Applications: IHC, IHC-P
NLS830
Species: Hu, Po, Bt, Ca, Eq, Mk, Pm, Rb
Applications: WB, IHC, IHC-P
NBP1-93967
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-69122
Species: Hu
Applications: WB
NB100-93551
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007290-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-98506
Species: Mu
Applications: WB
AF1007
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF6394
Species: Hu
Applications: WB, IP
NBP2-33469
Species: Hu
Applications: IHC, IHC-P
NBP2-37583
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-45478
Species: Hu, Mu, Rt, Mk
Applications: WB, IHC
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
NBP1-85861
Species: Hu
Applications: WB, IHC, IHC-P

Publications for FAM13A Recombinant Protein (H00010144-P01) (0)

There are no publications for FAM13A Recombinant Protein (H00010144-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM13A Recombinant Protein (H00010144-P01) (0)

There are no reviews for FAM13A Recombinant Protein (H00010144-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM13A Recombinant Protein (H00010144-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FAM13A Products

Bioinformatics Tool for FAM13A Recombinant Protein (H00010144-P01)

Discover related pathways, diseases and genes to FAM13A Recombinant Protein (H00010144-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM13A Recombinant Protein (H00010144-P01)

Discover more about diseases related to FAM13A Recombinant Protein (H00010144-P01).
 

Pathways for FAM13A Recombinant Protein (H00010144-P01)

View related products by pathway.

Blogs on FAM13A

There are no specific blogs for FAM13A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FAM13A Antibody
NBP1-88825
IRP2 Antibody
NB100-1798

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FAM13A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM13A