FAAP Antibody

Images

 
Western Blot: FAAP Antibody [NBP1-56855] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: HepG2 cell lysate
Immunohistochemistry: FAAP Antibody [NBP1-56855] - Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: 1:100 Secondary Antibody: ...read more
Western Blot: FAAP Antibody [NBP1-56855] - Hela, Antibody Dilution: 1.0 ug/ml RTCB is supported by BioGPS gene expression data to be expressed in HeLa.
Western Blot: FAAP Antibody [NBP1-56855] - Jurkat, Antibody Dilution: 1.0 ug/ml RTCB is supported by BioGPS gene expression data to be expressed in Jurkat.
Western Blot: FAAP Antibody [NBP1-56855] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml
Western Blot: FAAP Antibody [NBP1-56855] - Sample Type: Human Fetal Lung Antibody Dilution: 1.0 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAAP Antibody Summary

Immunogen
Synthetic peptides corresponding to C22ORF28 The peptide sequence was selected from the N terminal of C22ORF28. Peptide sequence PEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQAMFDHIPVGVG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C22ORF28
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against C22orf28 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FAAP Antibody

  • ankyrin repeat domain 54
  • C22orf28
  • chromosome 22 open reading frame 28
  • DJ149A16.6
  • EC 6.5.1.3
  • HSPC117
  • hypothetical protein LOC51493
  • novel protein HSPC117
  • RP1-149A16.6

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-07463
Species: Hu
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5414
Species: Hu
Applications: WB, Simple Western
NBP1-77051
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-46218
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-84487
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FAAP Antibody (NBP1-56855) (0)

There are no publications for FAAP Antibody (NBP1-56855).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAAP Antibody (NBP1-56855) (0)

There are no reviews for FAAP Antibody (NBP1-56855). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAAP Antibody (NBP1-56855) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAAP Products

Bioinformatics Tool for FAAP Antibody (NBP1-56855)

Discover related pathways, diseases and genes to FAAP Antibody (NBP1-56855). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAAP Antibody (NBP1-56855)

Discover more about diseases related to FAAP Antibody (NBP1-56855).
 

Pathways for FAAP Antibody (NBP1-56855)

View related products by pathway.

Blogs on FAAP

There are no specific blogs for FAAP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAAP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C22ORF28
Uniprot