EYS/RP25 Partial Protein

Images

 
There are currently no images for EYS/RP25 Partial Recombinant Protein (H00346007-Q01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

EYS/RP25 Partial Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 309 - 407 of Human EYS partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:HVVVIQNQTLIKAYINNSLILSEDIDPHKNFVALNYDGICYLGGFEYGRKVNIVTQEIFKTNFVGKIKDVVFFQEPKNIELIKLEGYNVYDGDEQNEVT

Protein/Peptide Type
Partial Protein
Gene
EYS

Applications/Dilutions

Application Notes
Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EYS/RP25 Partial Protein

  • C6orf178
  • C6orf179
  • C6orf180
  • dJ22I17.2
  • dJ303F19.1
  • EGFL10
  • EGFL11
  • EGF-like-domain, multiple 10
  • EGF-like-domain, multiple 11
  • eyes shut homolog (Drosophila)
  • protein spacemaker homolog

Background

LOC442228 - similar to dJ22I17.2 (novel protein with EGF-like and laminin G domains)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81637
Species: Hu
Applications: WB, IHC, IHC-P
PP-H7223-00
Species: Hu
Applications: WB, IHC, DirELISA
NBP2-56113
Species: Hu
Applications: IHC-P
AF591
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP1-30032
Species: Hu, Mu, Bv, Xp
Applications: WB, IHC, IHC-Fr
NBP1-87312
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84412
Species: Hu
Applications: IHC, IHC-P
NBP1-92335
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-78444
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-33569
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
H00006785-Q01
Species: Hu
NLS1049
Species: Hu, Eq, Mk, Pm
Applications: IHC-P, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB100-2911
Species: Hu
Applications: WB, ICC/IF
NBP1-71688
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF
AF550
Species: Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)

Publications for EYS/RP25 Partial Recombinant Protein (H00346007-Q01) (0)

There are no publications for EYS/RP25 Partial Recombinant Protein (H00346007-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EYS/RP25 Partial Recombinant Protein (H00346007-Q01) (0)

There are no reviews for EYS/RP25 Partial Recombinant Protein (H00346007-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EYS/RP25 Partial Recombinant Protein (H00346007-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EYS/RP25 Products

Bioinformatics Tool for EYS/RP25 Partial Recombinant Protein (H00346007-Q01)

Discover related pathways, diseases and genes to EYS/RP25 Partial Recombinant Protein (H00346007-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EYS/RP25 Partial Recombinant Protein (H00346007-Q01)

Discover more about diseases related to EYS/RP25 Partial Recombinant Protein (H00346007-Q01).
 

Pathways for EYS/RP25 Partial Recombinant Protein (H00346007-Q01)

View related products by pathway.

Blogs on EYS/RP25

There are no specific blogs for EYS/RP25, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EYS/RP25 Partial Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EYS