Ext2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Ext2 Antibody [NBP2-58869] - Staining of human cell line SiHa shows localization to the Golgi apparatus.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ext2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ('AISYEEWNDPPAVKWGSVSNPLFLPLIPPQSQGFTAIVLTYDRVESLFRVITEVSKVPSLSKLLVVWNNQNKNPPEDSL',)
Specificity
Specificity of human Ext2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EXT2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Ext2 Recombinant Protein Antigen (NBP2-58869PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Ext2 Antibody

  • EC 2.4.1.224
  • EC 2.4.1.225
  • exostoses (multiple) 2
  • Exostosin 2
  • exostosin-2
  • EXT2
  • Glucuronosyl-N-acetylglucosaminyl-proteoglycan/N-acetylglucosaminyl-proteoglycan4-alpha-N-acetylglucosaminyltransferase
  • Multiple Exostoses Protein 2
  • N-acetylglucosaminyl-proteoglycan 4-beta-glucuronosyltransferase
  • Putative tumor suppressor protein EXT2
  • SOTV

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91875
Species: Hu, Mu
Applications: IHC, IHC-P
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2635
Species: Hu
Applications: WB
NBP1-31225
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16394
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6585
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
H00003087-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
MAB7936
Species: Hu
Applications: IHC, CyTOF-ready, ICFlow
AF2364
Species: Hu
Applications: WB, IHC
H00006934-M06
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-32796
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-02627
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-59322
Species: Hu
Applications: WB, IHC, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
MAB4214
Species: Mu
Applications: WB, IP
NBP2-58869
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for Ext2 Antibody (NBP2-58869) (0)

There are no publications for Ext2 Antibody (NBP2-58869).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ext2 Antibody (NBP2-58869) (0)

There are no reviews for Ext2 Antibody (NBP2-58869). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Ext2 Antibody (NBP2-58869) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Ext2 Products

Bioinformatics Tool for Ext2 Antibody (NBP2-58869)

Discover related pathways, diseases and genes to Ext2 Antibody (NBP2-58869). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ext2 Antibody (NBP2-58869)

Discover more about diseases related to Ext2 Antibody (NBP2-58869).
 

Pathways for Ext2 Antibody (NBP2-58869)

View related products by pathway.

PTMs for Ext2 Antibody (NBP2-58869)

Learn more about PTMs related to Ext2 Antibody (NBP2-58869).
 

Research Areas for Ext2 Antibody (NBP2-58869)

Find related products by research area.

Blogs on Ext2

There are no specific blogs for Ext2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ext2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EXT2