EXD2 Antibody

Images

 
Western Blot: EXD2 Antibody [NBP1-88405] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: EXD2 Antibody [NBP1-88405] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: EXD2 Antibody [NBP1-88405] - Staining of human kidney shows strong cytoplasmic positivity in cells in glomeruli.
Western Blot: EXD2 Antibody [NBP1-88405] - Analysis in human cell line A-431.
Immunohistochemistry-Paraffin: EXD2 Antibody [NBP1-88405] - Staining of human prostate shows moderate to strong nuclear and cytoplasmic postivity in glandular cells.
Immunohistochemistry-Paraffin: EXD2 Antibody [NBP1-88405] - Staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: EXD2 Antibody [NBP1-88405] - Staining of human testis shows strong cytoplasmic postivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EXD2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TSCHAISNYYDNHLKQQLAKEFQAPIGSEEGLRLLEDPERRQVRSGARALLNAESLPTQRKEELLQALREFYNTDVVTEEMLQEAASLETRISNENYVPHGLKVVQCH
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EXD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EXD2 Protein (NBP1-88405PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EXD2 Antibody

  • C14orf114
  • chromosome 14 open reading frame 114
  • DKFZp781A0133
  • DKFZp781L15100
  • EXDL2
  • exonuclease 3'-5' domain containing 2
  • exonuclease 3'-5' domain-containing protein 2
  • exonuclease 3'-5' domain-like 2
  • Exonuclease 3'-5' domain-like-containing protein 2
  • FLJ10738

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-42677
Species: Hu
Applications: IHC, IHC-P, IP, WB
NB100-182
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, RNAi, Simple Western, WB
AF4377
Species: Hu, Mu
Applications: ICC, Simple Western, WB
MAB7745
Species: Hu
Applications: IHC, KO, Simple Western, WB
NBP1-88871
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88405
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for EXD2 Antibody (NBP1-88405) (0)

There are no publications for EXD2 Antibody (NBP1-88405).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EXD2 Antibody (NBP1-88405) (0)

There are no reviews for EXD2 Antibody (NBP1-88405). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EXD2 Antibody (NBP1-88405) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EXD2 Products

Bioinformatics Tool for EXD2 Antibody (NBP1-88405)

Discover related pathways, diseases and genes to EXD2 Antibody (NBP1-88405). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for EXD2 Antibody (NBP1-88405)

View related products by pathway.

Blogs on EXD2

There are no specific blogs for EXD2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EXD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EXD2