EVI5 Antibody - BSA Free

Western Blot: EVI5 Antibody [NBP2-87373] - Host: Rabbit. Target Name: EVI5. Sample Tissue: Human HCT15 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Discontinued

EVI5 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human EVI5. Peptide sequence: NSLQETGVGFPLHGKSGSMSLDPAVADGSESETEDSVLETRESNQVVQKE The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EVI5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for EVI5 Antibody - BSA Free

• dJ846D11.1 (ecotropic viral integration site 5)
• ecotropic viral integration site 5 protein homolog
• ecotropic viral integration site 5
• EVI-5
• NB4SNeuroblastoma stage 4S gene protein

Background

EVI5 is a novel centrosomal protein with a complex expression pattern and subcellular localization, possibly involved in centrosome stability and dynamics. It may act as an oncogene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EVI5