EVA1/MPZL2 Antibody - BSA Free

Western Blot: EVA1/MPZL2 Antibody [NBP1-59230] - MPZL2 Antibody [NBP1-59230] - Titration: 0.2-1 ug/ml, Positive Control: OVCAR-3 cell lysate.

Product Discontinued

EVA1/MPZL2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to MPZL2(myelin protein zero-like 2) The peptide sequence was selected from the N terminal of MPZL2. Peptide sequence LEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPF. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MPZL2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for EVA1/MPZL2 Antibody - BSA Free

• EVA1
• EVAEpithelial V-like antigen 1EVA1myelin protein zero-like protein 2
• MPZL2
• myelin protein zero-like 2

Background

Epithelial V-like antigen (EVA) is expressed in thymus epithelium and strongly downregulated by thymocyte developmental progression. This gene is expressed in the thymus and in several epithelial structures early in embryogenesis. It is highly homologous

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MPZL2
• Uniprot:
  • O70255(Mouse)