ERK3/MAPK6 Recombinant Protein Antigen

Images

 
There are currently no images for ERK3/MAPK6 Protein (NBP1-84806PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ERK3/MAPK6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAPK6.

Source: E. coli

Amino Acid Sequence: YSFPMDEPISSHPFHIEDEVDDILLMDETHSHIYNWERYHDCQFSEHDWPVHNNFDIDEVQLDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTNYSTEPCWQYSDHHENKYCDLECSH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MAPK6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84806.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ERK3/MAPK6 Recombinant Protein Antigen

  • DKFZp686F03189
  • EC 2.7.11
  • EC 2.7.11.24
  • ERK3
  • ERK-3
  • ERK3p97-MAPK
  • Extracellular signal-regulated kinase 3
  • extracellular signal-regulated kinase, p97
  • HsT17250
  • MAP kinase 6
  • MAP kinase isoform p97
  • MAPK 6
  • MAPK6
  • mitogen-activated protein kinase 6
  • p97MAPK
  • PRKM6
  • protein kinase, mitogen-activated 5
  • protein kinase, mitogen-activated 6

Background

ERK3 (Extracellular signal-regulated kinase 3, MAPK6, p97 MAPK) belongs to the Ser/Thr protein kinase family and is a member of the mitogen-activated protein (MAP) kinase superfamily. Unlike the other members of the MAPK family, ERK3 is a mitogen-activated protein kinase homologue that has SEG motif instead of conserved TXY motif in the activation loop (1). Also, unlike ERK1 and ERK2, it is ubiquitously expressed and localized in the nucleus of proliferating cells (2). Highly unstable, ERK3 is constitutively degraded during ubiquitin-proteasome pathway of proliferating cells (3). ERK3 has been linked to phosphorylation MAP2 and as a possible regulator during cell differentiation (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87231
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45743
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF1347
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
AF2848
Species: Hu, Mu
Applications: ICC, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-00764
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-81575
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-68874
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
H00010598-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
MAB4540
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-84806PEP
Species: Hu
Applications: AC

Publications for ERK3/MAPK6 Protein (NBP1-84806PEP) (0)

There are no publications for ERK3/MAPK6 Protein (NBP1-84806PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERK3/MAPK6 Protein (NBP1-84806PEP) (0)

There are no reviews for ERK3/MAPK6 Protein (NBP1-84806PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ERK3/MAPK6 Protein (NBP1-84806PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ERK3/MAPK6 Products

Research Areas for ERK3/MAPK6 Protein (NBP1-84806PEP)

Find related products by research area.

Blogs on ERK3/MAPK6

There are no specific blogs for ERK3/MAPK6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ERK3/MAPK6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MAPK6