ENPP6 Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptides corresponding to ENPP6(ectonucleotide pyrophosphatase/phosphodiesterase 6) The peptide sequence was selected from the middle region of ENPP6.
Peptide sequence ELMDMRGIFLAFGPDFKSNFRAAPIRSVDVYNVMCNVVGITPLPNNGSWS. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ENPP6 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for ENPP6 Antibody - BSA Free
Background
ENPP6 is a choline-specific glycerophosphodiester phosphodiesterase. ENPP6 hydrolyzes the classical substrate for phospholipase C, p-nitrophenyl phosphorylcholine, while it does not hydrolyze the classical nucleotide phosphodiesterase substrate, p-nitrophenyl thymidine 5'-monophosphate. ENPP6 hydrolyzes lysophosphatidylcholine (LPC) to form monoacylglycerol and phosphorylcholine but not lysophosphatidic acid, showing it has a lysophospholipase C activity. ENPP6 has a preference for LPC with short (12:0 and 14:0) or polyunsaturated (18:2 and 20:4) fatty acids. Also hydrolyzes glycerophosphorylcholine and sphingosylphosphorylcholine efficiently.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: EnzAct
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Mu
Applications: EnzAct
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Ch, Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Mu
Applications: IHC, IP, WB
Species: Hu
Applications: DirELISA, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Eq, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: WB
Publications for ENPP6 Antibody (NBP1-57954) (0)
There are no publications for ENPP6 Antibody (NBP1-57954).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ENPP6 Antibody (NBP1-57954) (0)
There are no reviews for ENPP6 Antibody (NBP1-57954).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ENPP6 Antibody (NBP1-57954) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ENPP6 Products
Research Areas for ENPP6 Antibody (NBP1-57954)
Find related products by research area.
|
Blogs on ENPP6