Recombinant Human EIF2G GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human EIF2G GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-472 of Human EIF2S3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAGGEAGVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKLKHILILQNKIDLVKESQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIVKKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQEIEVRPGIVSKDSEGKLMCKPIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQVLGAVGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
EIF2S3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
77.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EIF2G GST (N-Term) Protein

  • EIF2
  • eIF-2gA
  • eIF-2-gamma X
  • EIF2gamma
  • EIF2Geukaryotic translation initiation factor 2, subunit 3 (gamma, 52kD)
  • eIF-2gX
  • eukaryotic translation initiation factor 2 subunit 3
  • Eukaryotic translation initiation factor 2 subunit gamma X
  • eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa
  • eukaryotic translation initiation factor 2G

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008894-M09
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-268
Species: Hu, Po
Applications: WB, IP
NBP1-84877
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-16293
Species: Hu
Applications: WB, ICC/IF
NBP2-16292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83139
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-80467
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-80948
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
AF8519
Species: Hu, Mu, Rt
Applications: WB
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-75478
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP3-05634
Species: Mu, Rt
Applications: WB, ICC/IF, IF
NB100-55328
Species: Hu
Applications: WB, IP
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P

Publications for EIF2G Recombinant Protein (H00001968-P01) (0)

There are no publications for EIF2G Recombinant Protein (H00001968-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIF2G Recombinant Protein (H00001968-P01) (0)

There are no reviews for EIF2G Recombinant Protein (H00001968-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EIF2G Recombinant Protein (H00001968-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional EIF2G Products

Array H00001968-P01

Bioinformatics Tool for EIF2G Recombinant Protein (H00001968-P01)

Discover related pathways, diseases and genes to EIF2G Recombinant Protein (H00001968-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EIF2G Recombinant Protein (H00001968-P01)

Discover more about diseases related to EIF2G Recombinant Protein (H00001968-P01).
 

Pathways for EIF2G Recombinant Protein (H00001968-P01)

View related products by pathway.

PTMs for EIF2G Recombinant Protein (H00001968-P01)

Learn more about PTMs related to EIF2G Recombinant Protein (H00001968-P01).
 

Research Areas for EIF2G Recombinant Protein (H00001968-P01)

Find related products by research area.

Blogs on EIF2G

There are no specific blogs for EIF2G, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EIF2G GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF2S3