Recombinant Human EIF2G Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human EIF2G Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-472 of Human EIF2S3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAGGEAGVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKLKHILILQNKIDLVKESQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIVKKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQEIEVRPGIVSKDSEGKLMCKPIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQVLGAVGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
EIF2S3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EIF2G Protein

  • EIF2
  • eIF-2gA
  • eIF-2-gamma X
  • EIF2gamma
  • EIF2Geukaryotic translation initiation factor 2, subunit 3 (gamma, 52kD)
  • eIF-2gX
  • eukaryotic translation initiation factor 2 subunit 3
  • Eukaryotic translation initiation factor 2 subunit gamma X
  • eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa
  • eukaryotic translation initiation factor 2G

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008894-M09
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
NBP2-38572
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16293
Species: Hu
Applications: WB, ICC/IF
NBP2-58544
Species: Hu
Applications: WB, ICC/IF
AF5675
Species: Hu, Mu, Rt
Applications: WB, IHC
AF3795
Species: Hu
Applications: WB, IP
22240002
Species: Hu
Applications: WB, ELISA
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
AF8519
Species: Hu, Mu, Rt
Applications: WB
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
H00004622-R01
Species: Hu
NBP2-55541
Species: Hu
Applications: WB, ICC/IF
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P

Publications for EIF2G Recombinant Protein (H00001968-P01) (0)

There are no publications for EIF2G Recombinant Protein (H00001968-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIF2G Recombinant Protein (H00001968-P01) (0)

There are no reviews for EIF2G Recombinant Protein (H00001968-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EIF2G Recombinant Protein (H00001968-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EIF2G Products

Bioinformatics Tool for EIF2G Recombinant Protein (H00001968-P01)

Discover related pathways, diseases and genes to EIF2G Recombinant Protein (H00001968-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EIF2G Recombinant Protein (H00001968-P01)

Discover more about diseases related to EIF2G Recombinant Protein (H00001968-P01).
 

Pathways for EIF2G Recombinant Protein (H00001968-P01)

View related products by pathway.

PTMs for EIF2G Recombinant Protein (H00001968-P01)

Learn more about PTMs related to EIF2G Recombinant Protein (H00001968-P01).
 

Research Areas for EIF2G Recombinant Protein (H00001968-P01)

Find related products by research area.

Blogs on EIF2G

There are no specific blogs for EIF2G, but you can read our latest blog posts.

Customers Who Bought This Also Bought

EIF2G Antibody (2C9)
H00001968-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EIF2G Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF2S3