EGR2 Antibody (1F6V7)

Western Blot: EGR2 Antibody (1F6V7) [NBP3-16157] - Western blot analysis of extracts of various cell lines, using EGR2 Rabbit mAb (NBP3-16157) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Immunoprecipitation: EGR2 Antibody (1F6V7) [NBP3-16157] - Immunoprecipitation analysis of 600ug extracts of Mouse brain cells using 3ug EGR2 antibody (NBP3-16157). Western blot was performed from the immunoprecipitate using EGR2 antibody (NBP3-16157) at a dilition of 1:500.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IP
• Clone: 1F6V7
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

EGR2 Antibody (1F6V7) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human EGR2 (NP_000390.2). MMTAKAVDKIPVTLSGFVHQLSDNIYPVEDLAATSVTIFPNAELGGPFDQMNGVAGDGMINIDMTGEKRSLDLPYPSSFAPVSAPRNQTFTYMGKFSIDP
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: EGR2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunoprecipitation 1:100 - 1:500
  • Western Blot 1:100 - 1:500

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for EGR2 Antibody (1F6V7)

• AT591
• CMT1D
• CMT4E
• early growth response 2 (Krox-20 homolog, Drosophila)
• early growth response 2
• early growth response protein 2
• EGR-2
• FLJ14547
• Krox-20 homolog, Drosophila
• KROX-20, Drosophila, homolog (early growth response-2)
• KROX20DKFZp686J1957
• Zinc finger protein Krox-20

Background

Early Growth Response 2 (EGR2) is an early growth response family member which binds to specific areas of DNA and helps control the activity of particular genes. Specifically, EGR2 activates several genes that are involved in the formation and maintenance of myelin, the fatty substance that covers and protects nerve cells.

Defects in EGR2 have been linked to a number of diseases including congenital hypomyelination neuropathy, Charcot-Marie-Tooth disease type 1D, and Dejerine-Sottas neuropathy. EGR 2 antibodies may be useful tools for nerurscience research.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EGR2