EFCAB4B Antibody

Images

 
Immunohistochemistry-Paraffin: EFCAB4B Antibody [NBP1-82687] - Staining of human stomach shows strong cytoplasmic, membranous and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EFCAB4B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PDGRVVSRPQRLGQGSGQGPKGSGACLHPLDSLEQKETQEQTSGQLVMLRKAQEFFQTCDAEGKGFIARKDMQRLHKELPLSLEELEDVFDALDA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EFCAB4B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
EFCAB4B Protein (NBP1-82687PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EFCAB4B Antibody

  • Calcium release-activated calcium channel regulator 2A
  • CRAC channel regulator 2A
  • CRACR2A
  • DKFZp686G13246
  • EF-hand calcium binding domain 4B
  • EF-hand calcium-binding domain-containing protein 4B
  • FLJ33046
  • FLJ33805
  • MGC4266

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006786-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-75522
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00163688-D01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-14909
Species: Hu
Applications: WB, IP
AF4627
Species: Mu
Applications: WB, IHC
MAB8280
Species: Hu
Applications: WB
NBP2-01170
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86595
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for EFCAB4B Antibody (NBP1-82687) (0)

There are no publications for EFCAB4B Antibody (NBP1-82687).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EFCAB4B Antibody (NBP1-82687) (0)

There are no reviews for EFCAB4B Antibody (NBP1-82687). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for EFCAB4B Antibody (NBP1-82687) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EFCAB4B Products

Bioinformatics Tool for EFCAB4B Antibody (NBP1-82687)

Discover related pathways, diseases and genes to EFCAB4B Antibody (NBP1-82687). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EFCAB4B Antibody (NBP1-82687)

Discover more about diseases related to EFCAB4B Antibody (NBP1-82687).
 

Pathways for EFCAB4B Antibody (NBP1-82687)

View related products by pathway.

Blogs on EFCAB4B

There are no specific blogs for EFCAB4B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EFCAB4B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EFCAB4B