EEF1E1 Antibody - Azide and BSA Free

Western Blot: EEF1E1 Antibody [H00009521-B01P] - Analysis of EEF1E1 expression in HepG2.

Immunocytochemistry/Immunofluorescence: EEF1E1 Antibody [H00009521-B01P] - Analysis of purified antibody to EEF1E1 on HeLa cell. (antibody concentration 10 ug/ml)

Western Blot: EEF1E1 Antibody [H00009521-B01P] - Analysis of EEF1E1 expression in transfected 293T cell line by EEF1E1 polyclonal antibody. Lane 1: EEF1E1 transfected lysate(19.14 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

EEF1E1 Antibody - Azide and BSA Free Summary

• Immunogen: EEF1E1 (NP_004271.1, 1 a.a. - 174 a.a.) full-length human protein. MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH
• Specificity: Reacts with eukaryotic translation elongation factor 1 epsilon 1.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: EEF1E1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: This antibody is reactive against transfected lysate in western blot, immunofluorescence, and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EEF1E1 Antibody - Azide and BSA Free

• AIMP3Aminoacyl tRNA synthetase complex-interacting multifunctional protein 3
• ARS-interacting multifunctional protein 3
• Elongation factor p18
• eukaryotic translation elongation factor 1 epsilon 1
• eukaryotic translation elongation factor 1 epsilon-1
• Multisynthase complex auxiliary component p18
• p18 component of aminoacyl-tRNA synthetase complex
• P18

Background

This gene encodes a multifunctional protein that localizes both in the cytoplasm and in the nucleus. In the cytoplasm, the encoded protein is an auxiliary component of the macromolecular aminoacyl-tRNA synthase complex. However, its mouse homolog has been shown to translocate to the nucleus in response to DNA damage and plays a positive role in ATM/ATR-mediated p53 activation. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EEF1E1
• Entrez:
  • 9521(Human)
• Uniprot:
  • NP_004271.1(Human)