EEF1E1 Antibody

Images

 
Western Blot: EEF1E1 Antibody [H00009521-B01P] - Analysis of EEF1E1 expression in HepG2.
Immunocytochemistry/ Immunofluorescence: EEF1E1 Antibody [H00009521-B01P] - Analysis of purified antibody to EEF1E1 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: EEF1E1 Antibody [H00009521-B01P] - Analysis of EEF1E1 expression in transfected 293T cell line by EEF1E1 polyclonal antibody. Lane 1: EEF1E1 transfected lysate(19.14 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

EEF1E1 Antibody Summary

Immunogen
EEF1E1 (NP_004271.1, 1 a.a. - 174 a.a.) full-length human protein. MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH
Specificity
Reacts with eukaryotic translation elongation factor 1 epsilon 1.
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
EEF1E1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • Immunocytochemistry/Immunofluorescence
Application Notes
This antibody is reactive against transfected lysate in western blot, immunofluorescence, and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EEF1E1 Antibody

  • AIMP3Aminoacyl tRNA synthetase complex-interacting multifunctional protein 3
  • ARS-interacting multifunctional protein 3
  • Elongation factor p18
  • eukaryotic translation elongation factor 1 epsilon 1
  • eukaryotic translation elongation factor 1 epsilon-1
  • Multisynthase complex auxiliary component p18
  • p18 component of aminoacyl-tRNA synthetase complex
  • P18

Background

This gene encodes a multifunctional protein that localizes both in the cytoplasm and in the nucleus. In the cytoplasm, the encoded protein is an auxiliary component of the macromolecular aminoacyl-tRNA synthase complex. However, its mouse homolog has been shown to translocate to the nucleus in response to DNA damage and plays a positive role in ATM/ATR-mediated p53 activation. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB120-3216
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
NBP2-45603
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NB100-59774
Species: Hu
Applications: WB, IHC, IHC-P, IP, ChIP
NBP2-46085
Species: Hu
Applications: WB, IHC
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP, S-ELISA
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90949
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-74359
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP1-31308
Species: Hu, Mu, Rt, Bv, Fe
Applications: WB, ICC/IF, IHC, IHC-P
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA, KD
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13215
Species: Hu
Applications: WB, IHC, IHC-P

Publications for EEF1E1 Antibody (H00009521-B01P) (0)

There are no publications for EEF1E1 Antibody (H00009521-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EEF1E1 Antibody (H00009521-B01P) (0)

There are no reviews for EEF1E1 Antibody (H00009521-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EEF1E1 Antibody (H00009521-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional EEF1E1 Products

Bioinformatics Tool for EEF1E1 Antibody (H00009521-B01P)

Discover related pathways, diseases and genes to EEF1E1 Antibody (H00009521-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EEF1E1 Antibody (H00009521-B01P)

Discover more about diseases related to EEF1E1 Antibody (H00009521-B01P).
 

Pathways for EEF1E1 Antibody (H00009521-B01P)

View related products by pathway.

PTMs for EEF1E1 Antibody (H00009521-B01P)

Learn more about PTMs related to EEF1E1 Antibody (H00009521-B01P).
 

Research Areas for EEF1E1 Antibody (H00009521-B01P)

Find related products by research area.

Blogs on EEF1E1

There are no specific blogs for EEF1E1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EEF1E1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EEF1E1
Entrez
Uniprot