EDARADD Recombinant Protein Antigen

Images

 
There are currently no images for EDARADD Protein (NBP1-86440PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

EDARADD Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EDARADD.

Source: E. coli

Amino Acid Sequence: PTISDLLNDQDLLDVIRIKLDPCHPTVKNWRNFASKWGMSYDELCFLEQRPQSPTLEFLLRNSQRTVGQLMELCRLYHRADVEKVLRRWVDEEWPKRERGDP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EDARADD
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86440.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for EDARADD Recombinant Protein Antigen

  • crinkled homolog
  • ectodysplasia A receptor associated death domain
  • ectodysplasin A receptor associated adapter protein
  • ectodysplasin-A receptor-associated adapter protein
  • ED3
  • EDA3
  • EDAR-associated death domain protein
  • EDAR-associated death domain
  • Protein crinkled homolog

Background

The EDARADD gene was identified by its association with ectodermal dysplasia, a genetic disorder characterized by defectivedevelopment of hair, teeth, and eccrine sweat glands. The protein encoded by this gene is a death domain-containingprotein, and is found to

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF745
Species: Mu
Applications: Block, WB
3944-ED
Species: Hu
Applications: Bind
NBP2-26506
Species: Hu, Mu, Rt
Applications: B/N, In vitro
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
AF723
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-26504
Species: Hu, Mu, Rt
Applications: B/N, Func-Inh, In vitro, In vivo
NBP3-25708
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF3876
Species: Hu, Mu
Applications: IHC, WB
NBP1-81872
Species: Hu
Applications: IHC,  IHC-P
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NBP1-76916
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF1093
Species: Hu
Applications: Block, WB

Publications for EDARADD Protein (NBP1-86440PEP) (0)

There are no publications for EDARADD Protein (NBP1-86440PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EDARADD Protein (NBP1-86440PEP) (0)

There are no reviews for EDARADD Protein (NBP1-86440PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for EDARADD Protein (NBP1-86440PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EDARADD Products

Research Areas for EDARADD Protein (NBP1-86440PEP)

Find related products by research area.

Blogs on EDARADD

There are no specific blogs for EDARADD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our EDARADD Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol EDARADD