Ebf4 Antibody (4E10) - Azide and BSA Free

Western Blot: Ebf4 Antibody (4E10) [H00057593-M04] - Analysis of EBF4 expression in transfected 293T cell line by EBF4 monoclonal antibody (M04), clone 4E10. Lane 1: EBF4 transfected lysate (Predicted MW: 9.1 KDa). Lane 2: Non-transfected lysate.

Sandwich ELISA: Ebf4 Antibody (4E10) [H00057593-M04] - Detection limit for recombinant GST tagged EBF4 is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4E10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Ebf4 Antibody (4E10) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse Ebf4 Antibody (4E10) - Azide and BSA Free (H00057593-M04) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: EBF4 (AAH54347.1, 1 a.a. ~ 88 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPSSPPLAAASSMSLPAAAPTTSVFSFSPVNMISAVKQRSAFAPVLRPPSSPPQACPRAHGEGLPDQSFEDSDKFHSPARGLQGLAYS
• Specificity: This product is specific for Human EBF4 monoclonal antibody (M04), clone 4E10 [Gene ID: 57593].
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: EBF4
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: Mouse monoclonal antibody raised against a full-length recombinant EBF4.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Ebf4 Antibody (4E10) - Azide and BSA Free

• early B-cell factor 4
• EBF-4
• olf-1/EBF-like 4
• transcription factor COE4

Background

EBF4 belongs to the conserved Olf/EBF family of helix-loop-helix transcription factors, members of which play importantroles in neural development and B-cell maturation (Wang et al., 2002 (PubMed 12139918)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EBF4
• Uniprot:
  • AAH54347.1(Human)