EAF1 Antibody - Azide and BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 50-120 of human EAF1 (NP_149074.3). LQVGKGDEVTITLPHIPGSTPPMTVFKGNKRPYQKDCVLIINHDTGEYVLEKLSSSIQVKKTRAEGSSKIQ |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
EAF1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500-1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for EAF1 Antibody - Azide and BSA Free
Background
EAF1 acts as a transcriptional transactivator of ELL and ELL2 elongation activities
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IP
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, IP (-), WB
Species: Hu
Applications: ChIP-EXO-SEQ, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, , WB
Species: Hu, Mu
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: WB
Species: Hu, Rt
Applications: WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for EAF1 Antibody (NBP2-92383) (0)
There are no publications for EAF1 Antibody (NBP2-92383).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for EAF1 Antibody (NBP2-92383) (0)
There are no reviews for EAF1 Antibody (NBP2-92383).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for EAF1 Antibody (NBP2-92383) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional EAF1 Products
Research Areas for EAF1 Antibody (NBP2-92383)
Find related products by research area.
|
Blogs on EAF1