Recombinant Human E2F3 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human E2F3 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-133 of Human E2F3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MQSGGGVKTDDTSTLNSLCGYAWVYVWEEKQRCRLSSFFSSSASIPGLLPSHTLDLVQNVGVVLDEALGWGRERELCVKCLLEMHCGVFSCMGNHLCQAFPHFPYLSHLVSCLCFQLCVILFASCTKLIFSKV

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
E2F3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
40.37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human E2F3 GST (N-Term) Protein

  • DKFZp686C18211
  • E2F transcription factor 3
  • E2F-3
  • KIAA0075
  • MGC104598
  • transcription factor E2F3

Background

E2F3( AAH16847, 1 a.a. - 134 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67899
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF5119
Species: Hu
Applications: WB
NBP1-21374
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
NBP1-26616
Species: Hu
Applications: WB, IP
NBP2-82955
Species: Hu
Applications: WB
NBP2-33735
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-38206
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-00776
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, All-NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-92865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-46085
Species: Hu
Applications: WB, IHC

Publications for E2F3 Recombinant Protein (H00001871-P01) (0)

There are no publications for E2F3 Recombinant Protein (H00001871-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for E2F3 Recombinant Protein (H00001871-P01) (0)

There are no reviews for E2F3 Recombinant Protein (H00001871-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for E2F3 Recombinant Protein (H00001871-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional E2F3 Products

Bioinformatics Tool for E2F3 Recombinant Protein (H00001871-P01)

Discover related pathways, diseases and genes to E2F3 Recombinant Protein (H00001871-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for E2F3 Recombinant Protein (H00001871-P01)

Discover more about diseases related to E2F3 Recombinant Protein (H00001871-P01).
 

Pathways for E2F3 Recombinant Protein (H00001871-P01)

View related products by pathway.

PTMs for E2F3 Recombinant Protein (H00001871-P01)

Learn more about PTMs related to E2F3 Recombinant Protein (H00001871-P01).
 

Research Areas for E2F3 Recombinant Protein (H00001871-P01)

Find related products by research area.

Blogs on E2F3

There are no specific blogs for E2F3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human E2F3 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol E2F3