DZIP3 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

DZIP3 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DZIP3.

  Source: E. coli

  Amino Acid Sequence: ESTMKTYVSKLNAETSRALTAEVYFLQCRRDFGLLHLEQTEKECLNQLARVTHMAASNLESLQLKAAVDSWNAIVADVRNKIAFLRTQYNEQINKVKQ

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: DZIP3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58053.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 29 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DZIP3 Recombinant Protein Antigen

• DAZ interacting protein 3, zinc finger
• DAZ-interacting protein 3
• E3 ubiquitin-protein ligase DZIP3
• EC 6.3.2.-
• FLJ13327
• FLJ57977
• FLJ58022
• FLJ58223
• hRUL138KIAA0675
• human RNA-binding ubiquitin ligase of 138 kDa
• RNA-binding ubiquitin ligase of 138 kDa
• UURF2 ubiquitin ligase
• UURF2
• zinc finger DAZ interacting protein 3

Background

The DZIP3 gene codes a E3 ubiquitin-protein ligase DZIP3 protein that in one isoform is 1,208 amino acids long and 138 kDA and in the other is 303 amino acids long at 35 kDA. These proteins are able to specifically bind RNA as well as control ubiquitination and proteasomal degradation of target proteins by receiving ubiquitin from an E2 ubiquitin-conjugating enzyme (in the form of a thioester) then transfers the material to targeted substrates. DZIP3 is active in adaptive immune system, protein modification, and antigen processing (specifically ubiquitination and proteasome degradation as described above). DZIP3 has been researched in various diseases such as azoospermia and ataxia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: DZIP3