DZIP3 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DZIP3. Source: E.coli Amino Acid Sequence: ESTMKTYVSKLNAETSRALTAEVYFLQCRRDFGLLHLEQTEKECLNQLARVTHMAASNLESLQLKAAVDSWNAIVADVRNKIAFLRTQYNEQINKVKQ |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
DZIP3 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This peptide is useful as a blocking peptide for NBP2-58053 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here. |
| Theoretical MW |
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Alternate Names for DZIP3 Recombinant Protein Antigen
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: WB, ChIP, IP, CHIP-SEQ
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, KO
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Sh
Applications: WB, ELISA, Flow, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, ChIP
Species: Hu
Applications: AC
Publications for DZIP3 Recombinant Protein Antigen (NBP2-58053PEP) (0)
There are no publications for DZIP3 Recombinant Protein Antigen (NBP2-58053PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DZIP3 Recombinant Protein Antigen (NBP2-58053PEP) (0)
There are no reviews for DZIP3 Recombinant Protein Antigen (NBP2-58053PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for DZIP3 Recombinant Protein Antigen (NBP2-58053PEP) (0)
Other Available Formats
Additional DZIP3 Products
Bioinformatics Tool for DZIP3 Recombinant Protein Antigen (NBP2-58053PEP)
Discover related pathways, diseases and genes to DZIP3 Recombinant Protein Antigen (NBP2-58053PEP). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for DZIP3 Recombinant Protein Antigen (NBP2-58053PEP)
Discover more about diseases related to DZIP3 Recombinant Protein Antigen (NBP2-58053PEP).
| | Pathways for DZIP3 Recombinant Protein Antigen (NBP2-58053PEP)
View related products by pathway.
|
Research Areas for DZIP3 Recombinant Protein Antigen (NBP2-58053PEP)
Find related products by research area.
|
Blogs on DZIP3
![Western Blot: NCOR1 Antibody [NB100-58824] - Whole cell lysate (50 ug) from HEK293T, K-562, and NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-NCoR antibodyused for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3minutes.](http://images.novusbio.com/images2/NCOR1-Antibody-Western-Blot-NB100-58824-img0002.jpg)
![Chromatin Immunoprecipitation Sequencing: NCOR1 Antibody [NB100-58824] - Localization of NCoR Binding Sites by ChIP-sequencing. Chromatin from K562 cells was immunoprecipitated with anti-NCoR antibody NB100-58824 and analyzed by DNA sequencing. The figure illustrates the peak distribution of NCoR binding within a 650 Kb region of the human X chromosome as detected using anti-NCoR antibody NB100-58824. ChIP-seq validation performed by Diogenode, Denville, NJ.](http://images.novusbio.com/images2/NCOR1 Antibody-Chromatin Immunoprecipitation Sequencing-NB100-58824-img0003.jpg)
![Immunoprecipitation: NCOR1 Antibody [NB100-58824] - Detection of Human NCOR on HeLa whole cell lysate using NB100-5882. NCOR was also immunoprecipitated by rabbit anti-NCOR antibody NB100-58825.](http://images.novusbio.com/images2/NCOR1-Antibody-Immunoprecipitation-NB100-58824-img0001.jpg)
![Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - Wild-type (WT) and DLD knockout (KO) HeLa cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with DLD antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.](http://images.novusbio.com/images2/Dihydrolipoamide-Dehydrogenase-DLD-Antibody-Western-Blot-NBP1-31302-img0014.jpg)
![Immunocytochemistry/Immunofluorescence: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: DLD protein stained by DLD antibody diluted at 1:500. Blue: Hoechst 33342 staining.](http://images.novusbio.com/images2/Dihydrolipoamide-Dehydrogenase-DLD-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-31302-img0013.jpg)
![Immunohistochemistry-Paraffin: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - Human gastric cancer, using DLD antibody at 1:100 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.](http://images.novusbio.com/images2/Dihydrolipoamide-Dehydrogenase-DLD-Antibody-Immunohistochemistry-Paraffin-NBP1-31302-img0008.jpg)
![Western Blot: UBR5/EDD Antibody [NB100-1591] - Samples: Whole cell lysate (50 ug) from HEK293T, Jurkat, and LNCaP cells prepared using NETN lysis buffer. Antibody: Affinity purified Rabbit UBR5/EDD Antibody (NB100-1591, lot 6) used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.](http://images.novusbio.com/images2/UBR5-EDD-Antibody-Western-Blot-NB100-1591-img0003.jpg)
![Immunohistochemistry-Paraffin: UBR5/EDD Antibody [NB100-1591] - Sample: FFPE section of human lung carcinoma. Antibody: Affinity purified rabbit UBR5/EDD Antibody (NB100-1591, lot 6) used at a dilution of 1:1,000 (1 ug/ml). Detection: DAB](http://images.novusbio.com/images2/UBR5-EDD-Antibody-Immunohistochemistry-Paraffin-NB100-1591-img0002.jpg)
![Immunohistochemistry-Paraffin: UBR5/EDD Antibody [NB100-1591] - Sample: FFPE section of mouse plasmacytoma. Antibody: Affinity purified rabbit UBR5/EDD Antibody (NB100-1591, lot 6) used at a dilution of 1:1000 (1 ug/ml). Detection: DAB](http://images.novusbio.com/images2/UBR5-EDD-Antibody-Immunohistochemistry-Paraffin-NB100-1591-img0001.jpg)
![Knockout Validated: HDAC1 Antibody [NB100-56340] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and HDAC1 knockout (KO) HeLa cell line. PVDF membrane was probed with 2.0 ug/ml of Rabbit Anti-Human HDAC1 Polyclonal Antibody (Catalog # NB100-56340) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for HDAC1 at approximately 65 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.](http://images.novusbio.com/images2/HDAC1-Antibody-Knockout-Validated-NB100-56340-img0007.jpg)
![Western Blot: HDAC1 Antibody [NB100-56340] - Analysis of HDAC1 in HEK293 cell lysate with this antibody.](http://images.novusbio.com/images2/HDAC1-Antibody-Western-Blot-NB100-56340-img0002.jpg)
![Immunohistochemistry-Paraffin: HDAC1 Antibody [NB100-56340] - Human testis using HDAC1 antibody at 1:250 on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Staining was performed by Histowiz.](http://images.novusbio.com/images2/HDAC1-Antibody-Immunohistochemistry-Paraffin-NB100-56340-img0005.jpg)
![Western Blot: ALDH9A1 Antibody [NBP1-89150] - Analysis in rat cell line NBT-II.](http://images.novusbio.com/images2/ALDH9A1-Antibody-Western-Blot-NBP1-89150-img0009.jpg)
![Immunohistochemistry-Paraffin: ALDH9A1 Antibody [NBP1-89150] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/images2/ALDH9A1-Antibody-Immunohistochemistry-Paraffin-NBP1-89150-img0002.jpg)
![Western Blot: ALDH9A1 Antibody [NBP1-89150] - Analysis in human cell line TD47D.](http://images.novusbio.com/images2/ALDH9A1-Antibody-Western-Blot-NBP1-89150-img0008.jpg)
![Western Blot: ILT6/CD85e/LILRA3 Antibody (2E9) [H00011026-M01] - Analysis of LILRA3 expression in transfected 293T cell line by LILRA3 monoclonal antibody (M01), clone 2E9.Lane 1: LILRA3 transfected lysate(50.485 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/images2/ILT6-CD85e-LILRA3 Antibody (2E9)-Western Blot-H00011026-M01-img0002.jpg)
![Western Blot: HDAC3 Antibody [NB100-1669] - Analysis of HDAC3 in HeLa cell lysate with anti-HDAC3 this antibody.](http://images.novusbio.com/images2/HDAC3-Antibody-Western-Blot-NB100-1669-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: HDAC3 Antibody [NB100-1669] - HDAC3 preferably binds to nuclear Htt with long Qs. HDAC3 associates exclusively with nuclear inclusion bodies. E3 or N3 cells were fixed and stained with anti-HDAC3 antibodies and visualized by Alexa 546 conjugated secondary antibodies. Arrowheads: inclusion bodies with no HDAC3 signals associated. Arrows: HDAC3 signal-associated inclusion bodies. Bar?=?20 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0111277), licensed under a CC-BY licence.](http://images.novusbio.com/images2/HDAC3 Antibody-Immunocytochemistry-Immunofluorescence-NB100-1669-img0008.jpg)
![Immunohistochemistry-Paraffin: HDAC3 Antibody [NB100-1669] - Analysis human colon cancer using 1:50 conc. of HDAC3 antibody on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Nuclear staining of HDAC3 was observed. Staining was performed by Histowiz.](http://images.novusbio.com/images2/HDAC3-Antibody-Immunohistochemistry-Paraffin-NB100-1669-img0007.jpg)
![Western Blot: SSRP1 Antibody [NBP2-80439] - Analysis of SSRP1 on Daudi cell lysate. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (NBP2-80439, 1/500) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5,000 dilution was used for 1 hour at room temperature.](http://images.novusbio.com/images2/SSRP1-Antibody-Western-Blot-NBP2-80439-img0006.jpg)
![Immunohistochemistry-Paraffin: SSRP1 Antibody [NBP2-80439] - Analysis in mouse colon tissue using SSRP1 antibody. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6.0) for 20 minutes. The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with d](http://images.novusbio.com/images2/SSRP1-Antibody-Immunohistochemistry-Paraffin-NBP2-80439-img0005.jpg)
![Flow Cytometry: SSRP1 Antibody [NBP2-80439] - Analysis of SSRP1 was done on SH-SY5Y cells. The cells were fixed, permeabilized and stained with the primary antibody (1/50) (red). After incubation of the primary antibody at room temperature for an hour, the cells were stained with a Alexa Fluor 488-conjugated Goat anti-Rabbit IgG Secondary antibody at 1/1000 dilution for 30 minutes. Unlabeled sample was used as a control (cells without incubation with primary antibody; black).](http://images.novusbio.com/images2/SSRP1-Antibody-Flow-Cytometry-NBP2-80439-img0001.jpg)
![Western Blot: Histone H2a Antibody [NB100-56346] - Histone H2A in MCF-7 and HCT-116 cells. Image from verified customer review.](http://images.novusbio.com/images2/Histone-H2a-Antibody-Western-Blot-NB100-56346-img0004.jpg)
![Immunohistochemistry-Paraffin: Histone H2a Antibody [NB100-56346] - Human breast probed with Histone H2A antibody at 5 ug/ml. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.](http://images.novusbio.com/images2/Histone-H2a-Antibody-Immunohistochemistry-Paraffin-NB100-56346-img0006.jpg)
![Western Blot: Histone H2a Antibody [NB100-56346] - Analysis of Histone H2A in human PBMC lysate probed with Histone H2A antibody.](http://images.novusbio.com/images2/Histone H2a Antibody-Western Blot-NB100-56346-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: NCOR2 Antibody [NB120-5802] - Immunofluorescent analysis of NCoR2 (green) showing staining in the nucleus of U251 cells (right) compared to a negative control without primary antibody (left).](http://images.novusbio.com/images2/NCOR2-Antibody-Immunocytochemistry-Immunofluorescence-NB120-5802-img0004.jpg)
![Immunohistochemistry: NCOR2 Antibody [NB120-5802] - Immunohistochemistry analysis of NCoR2 showing positive staining in the nucleus of paraffin-treated Human lung tissue (right) compared with a negative control in the absence of primary antibody (left).](http://images.novusbio.com/images2/NCOR2-Antibody-Immunohistochemistry-NB120-5802-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: NCOR2 Antibody [NB120-5802] - Immunofluorescent analysis of NCoR2 (green) showing staining in the nucleus of Neuro-2a cells (right) compared to a negative control without primary antibody (left).](http://images.novusbio.com/images2/NCOR2-Antibody-Immunocytochemistry-Immunofluorescence-NB120-5802-img0001.jpg)