DZIP3 Recombinant Protein Antigen

Images

 
There are currently no images for DZIP3 Recombinant Protein Antigen (NBP2-58053PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DZIP3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DZIP3.

Source: E. coli

Amino Acid Sequence: ESTMKTYVSKLNAETSRALTAEVYFLQCRRDFGLLHLEQTEKECLNQLARVTHMAASNLESLQLKAAVDSWNAIVADVRNKIAFLRTQYNEQINKVKQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DZIP3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58053.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DZIP3 Recombinant Protein Antigen

  • DAZ interacting protein 3, zinc finger
  • DAZ-interacting protein 3
  • E3 ubiquitin-protein ligase DZIP3
  • EC 6.3.2.-
  • FLJ13327
  • FLJ57977
  • FLJ58022
  • FLJ58223
  • hRUL138KIAA0675
  • human RNA-binding ubiquitin ligase of 138 kDa
  • RNA-binding ubiquitin ligase of 138 kDa
  • UURF2 ubiquitin ligase
  • UURF2
  • zinc finger DAZ interacting protein 3

Background

The DZIP3 gene codes a E3 ubiquitin-protein ligase DZIP3 protein that in one isoform is 1,208 amino acids long and 138 kDA and in the other is 303 amino acids long at 35 kDA. These proteins are able to specifically bind RNA as well as control ubiquitination and proteasomal degradation of target proteins by receiving ubiquitin from an E2 ubiquitin-conjugating enzyme (in the form of a thioester) then transfers the material to targeted substrates. DZIP3 is active in adaptive immune system, protein modification, and antigen processing (specifically ubiquitination and proteasome degradation as described above). DZIP3 has been researched in various diseases such as azoospermia and ataxia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-28863
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-01109
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MAB6609
Species: Hu, Mu
Applications: IHC, WB
NB100-1591
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, KD, WB
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP1-89150
Species: Hu
Applications: IHC,  IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
NB100-1669
Species: Hu
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP1-33235
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NB100-56346
Species: Hu, Mu, Sh
Applications: ELISA, Flow, IHC,  IHC-P, WB
NB120-5802
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP2-58053PEP
Species: Hu
Applications: AC

Publications for DZIP3 Recombinant Protein Antigen (NBP2-58053PEP) (0)

There are no publications for DZIP3 Recombinant Protein Antigen (NBP2-58053PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DZIP3 Recombinant Protein Antigen (NBP2-58053PEP) (0)

There are no reviews for DZIP3 Recombinant Protein Antigen (NBP2-58053PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DZIP3 Recombinant Protein Antigen (NBP2-58053PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DZIP3 Products

Research Areas for DZIP3 Recombinant Protein Antigen (NBP2-58053PEP)

Find related products by research area.

Blogs on DZIP3

There are no specific blogs for DZIP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DZIP3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DZIP3