Recombinant Human DZIP3 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human DZIP3 Protein [H00009666-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human DZIP3 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1021-1120 of Human DZIP3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: PSAGLRSDPSIMNWERITDRLKTAFPQQTRKELTDFLRKLKDAYGKSLSELTFDEIVCKISQFIDPKKSQSQGKSVSNVNCVSPSHSPSQPDAAQPPKPA

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
DZIP3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DZIP3 GST (N-Term) Protein

  • DAZ interacting protein 3, zinc finger
  • DAZ-interacting protein 3
  • E3 ubiquitin-protein ligase DZIP3
  • EC 6.3.2.-
  • FLJ13327
  • FLJ57977
  • FLJ58022
  • FLJ58223
  • hRUL138KIAA0675
  • human RNA-binding ubiquitin ligase of 138 kDa
  • RNA-binding ubiquitin ligase of 138 kDa
  • UURF2 ubiquitin ligase
  • UURF2
  • zinc finger DAZ interacting protein 3

Background

DZIP3 - zinc finger DAZ interacting protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, CHIP-SEQ
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6609
Species: Hu, Mu
Applications: WB, IHC
NB100-1591
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, KD
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, KO
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NB100-1669
Species: Hu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-80439
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NB100-56346
Species: Hu, Mu, Sh
Applications: WB, ELISA, Flow, IHC, IHC-P
NB120-5802
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, ChIP
H00009666-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for DZIP3 Partial Recombinant Protein (H00009666-Q01) (0)

There are no publications for DZIP3 Partial Recombinant Protein (H00009666-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DZIP3 Partial Recombinant Protein (H00009666-Q01) (0)

There are no reviews for DZIP3 Partial Recombinant Protein (H00009666-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DZIP3 Partial Recombinant Protein (H00009666-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional DZIP3 Products

Bioinformatics Tool for DZIP3 Partial Recombinant Protein (H00009666-Q01)

Discover related pathways, diseases and genes to DZIP3 Partial Recombinant Protein (H00009666-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DZIP3 Partial Recombinant Protein (H00009666-Q01)

Discover more about diseases related to DZIP3 Partial Recombinant Protein (H00009666-Q01).
 

Pathways for DZIP3 Partial Recombinant Protein (H00009666-Q01)

View related products by pathway.

Research Areas for DZIP3 Partial Recombinant Protein (H00009666-Q01)

Find related products by research area.

Blogs on DZIP3

There are no specific blogs for DZIP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HDAC1 Antibody
NB100-56340

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DZIP3 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DZIP3