Dystroglycan Recombinant Protein Antigen

Images

 
There are currently no images for Dystroglycan Recombinant Protein Antigen (NBP3-17837PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Dystroglycan Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Dystroglycan

Source: E. coli

Amino Acid Sequence: WENQLEASMHSVLSDLHEAVPTVVGIPDGTAVVGRSFRVTIPTDLIASSGDIIKVSAAGKEALPSWLHWDSQSHTLEGLPLDTDKGVHY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DAG1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17837.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Dystroglycan Recombinant Protein Antigen

  • A3a
  • AGRNR
  • DAG1
  • Dag-1
  • DAG156DAG
  • dystroglycan 1 (dystrophin-associated glycoprotein 1)
  • Dystroglycan
  • Dystrophin-associated glycoprotein 1

Background

Dystroglycan (also known as dystrophin-associated glycoprotein 1) is a member of the dystroglycan family that contains the WWW binding motif PPxY. This protein has alpha and beta subunits with approximate molecular weights of 156 kD and 43-50 kD, respectively. The dystroglycan beta subunit is an integral membrane protein, the alpha subunit is a ubiquitously expressed extracellular protein. Muscle and non-muscle isoforms differ by carbohydrate moieties (not protein sequence). Dystroglycan functions as an adhesion molecule responsible for interactions between extracellular matrix and the subsarcolemmal cytoskeleton. Dsytroglycan binds to lamin in the matrix and dystrophin in the cytoskeleton; phosphorylation regulates the association of interacting proteins. Dystroglycan binds to utrophin when unphosphorylated; c-Src, Fyn, Csk, NCK, and SHC when phosphorylated. Dystroglycan interacts with dystrophin through the WW domain. The Poly6171 antibody recognizes human phosphorylated dystroglycan (Tyr893) and has been shown to be useful for Western blotting.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-89953
Species: Hu
Applications: IHC,  IHC-P
AF2364
Species: Hu
Applications: IHC, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-01763
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-46518
Species: Hu
Applications: IHC,  IHC-P, WB
H00002038-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP3-46899
Species: Hu
Applications: ELISA, ICC/IF, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP3-47447
Species: Hu, Rt
Applications: ELISA, IHC, WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
MAB5018
Species: Hu
Applications: IP, WB
NBP1-90300
Species: Hu
Applications: IHC,  IHC-P
NBP3-15472
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
550-AG
Species: Rt
Applications: BA, BA
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
236-EG
Species: Hu
Applications: BA
NBP3-17837PEP
Species: Hu
Applications: AC

Publications for Dystroglycan Recombinant Protein Antigen (NBP3-17837PEP) (0)

There are no publications for Dystroglycan Recombinant Protein Antigen (NBP3-17837PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dystroglycan Recombinant Protein Antigen (NBP3-17837PEP) (0)

There are no reviews for Dystroglycan Recombinant Protein Antigen (NBP3-17837PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Dystroglycan Recombinant Protein Antigen (NBP3-17837PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Dystroglycan Products

Research Areas for Dystroglycan Recombinant Protein Antigen (NBP3-17837PEP)

Find related products by research area.

Blogs on Dystroglycan.

Could Laminin be Used to Treat Duchenne Muscular Dystrophy?
Duchenne muscular dystrophy (DMD) is a severe muscle wasting condition, causing disability and early death. There is currently no cure or adequate treatment for DMD, but pioneering research indicates that injection of a laminin protein may prevent (or...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Dystroglycan Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DAG1