Recombinant Human Dystroglycan GST (N-Term) Protein Summary
Description |
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 31-140 of Human Alpha Dystroglycan Source: Wheat Germ (in vitro) Amino Acid Sequence: WPSEPSEAVRDWENQLEASMHSVLSDLHEAVPTVVGIPDGTAVVGRSFRVTIPTDLIASSGDIIKVSAAGKEALPSWLHWDSQSHTLEGLPLDTDKGVHYISVSATRLGA |
Preparation Method |
in vitro wheat germ expression system |
Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
Source |
Wheat germ |
Protein/Peptide Type |
Partial Recombinant Protein |
Gene |
DAG1 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- ELISA
- Immunoaffinity Purification
- Immunoprecipitation
- Protein Array
- Western Blot
|
Theoretical MW |
37.84 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Publications |
|
Packaging, Storage & Formulations
Storage |
Store at -80C. Avoid freeze-thaw cycles. |
Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human Dystroglycan GST (N-Term) Protein
Background
DAG1 - dystroglycan 1 (dystrophin-associated glycoprotein 1)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: PAGE
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Rt
Applications: BA, BA
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB, ELISA, IP, PA, AP
Publications for Alpha Dystroglycan Partial Recombinant Protein (H00001605-Q01)(3)
Showing Publications 1 -
3 of 3.
Publications using H00001605-Q01 |
Applications |
Species |
Crowe KE, Shao G, Flanigan KM, Martin PT N-terminal alpha Dystroglycan (alphaDG-N): A Potential Serum Biomarker for Duchenne Muscular Dystrophy. J Neuromuscul Dis 2016 May 27 [PMID: 27854211] |
|
|
Heng S, Vollenhoven B, Rombauts LJ, Nie G. A High-Throughput Assay for the Detection of alpha-Dystroglycan N-Terminus in Human Uterine Fluid to Determine Uterine Receptivity. J Biomol Screen 2015 Dec 2 [PMID: 26637554] |
|
|
Hesse C, Johansson I, Mattsson N et al. The N-terminal domain of alpha-dystroglycan, released as a 38kDa protein, is increased in cerebrospinal fluid in patients with Lyme neuroborreliosis. Biochem Biophys Res Commun. 2011 Aug 06 [PMID: 21843510] |
|
|
Reviews for Alpha Dystroglycan Partial Recombinant Protein (H00001605-Q01) (0)
There are no reviews for Alpha Dystroglycan Partial Recombinant Protein (H00001605-Q01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Alpha Dystroglycan Partial Recombinant Protein (H00001605-Q01) (0)
Additional Dystroglycan Products
Bioinformatics Tool for Alpha Dystroglycan Partial Recombinant Protein (H00001605-Q01)
Discover related pathways, diseases and genes to Alpha Dystroglycan Partial Recombinant Protein (H00001605-Q01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Alpha Dystroglycan Partial Recombinant Protein (H00001605-Q01)
Discover more about diseases related to Alpha Dystroglycan Partial Recombinant Protein (H00001605-Q01).
| | Pathways for Alpha Dystroglycan Partial Recombinant Protein (H00001605-Q01)
View related products by pathway.
|
PTMs for Alpha Dystroglycan Partial Recombinant Protein (H00001605-Q01)
Learn more about PTMs related to Alpha Dystroglycan Partial Recombinant Protein (H00001605-Q01).
| | Research Areas for Alpha Dystroglycan Partial Recombinant Protein (H00001605-Q01)
Find related products by research area.
|
Blogs on Dystroglycan.