Recombinant Human Dystroglycan Protein

Images

 
SDS-Page: Alpha Dystroglycan Partial Recombinant Protein [H00001605-Q01]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Dystroglycan Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 31-140 of Human Alpha Dystroglycan

Source: Wheat Germ

Amino Acid Sequence: WPSEPSEAVRDWENQLEASMHSVLSDLHEAVPTVVGIPDGTAVVGRSFRVTIPTDLIASSGDIIKVSAAGKEALPSWLHWDSQSHTLEGLPLDTDKGVHYISVSATRLGA

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
DAG1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using H00001605-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Dystroglycan Protein

  • A3a
  • AGRNR
  • DAG1
  • Dag-1
  • DAG156DAG
  • dystroglycan 1 (dystrophin-associated glycoprotein 1)
  • Dystroglycan
  • Dystrophin-associated glycoprotein 1

Background

DAG1 - dystroglycan 1 (dystrophin-associated glycoprotein 1)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF2364
Species: Hu
Applications: WB, IHC
H00005555-P01
Species: Hu
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-23368
Species: Hu
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
NBP1-84074
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-67150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-32569
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90300
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-59640
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb
Applications: WB, IHC, IHC-P
AF550
Species: Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-56713
Species: Hu
Applications: WB, ICC/IF
H00001605-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Alpha Dystroglycan Partial Recombinant Protein (H00001605-Q01)(3)

Reviews for Alpha Dystroglycan Partial Recombinant Protein (H00001605-Q01) (0)

There are no reviews for Alpha Dystroglycan Partial Recombinant Protein (H00001605-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Alpha Dystroglycan Partial Recombinant Protein (H00001605-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Dystroglycan Products

Bioinformatics Tool for Alpha Dystroglycan Partial Recombinant Protein (H00001605-Q01)

Discover related pathways, diseases and genes to Alpha Dystroglycan Partial Recombinant Protein (H00001605-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Alpha Dystroglycan Partial Recombinant Protein (H00001605-Q01)

Discover more about diseases related to Alpha Dystroglycan Partial Recombinant Protein (H00001605-Q01).
 

Pathways for Alpha Dystroglycan Partial Recombinant Protein (H00001605-Q01)

View related products by pathway.

PTMs for Alpha Dystroglycan Partial Recombinant Protein (H00001605-Q01)

Learn more about PTMs related to Alpha Dystroglycan Partial Recombinant Protein (H00001605-Q01).
 

Research Areas for Alpha Dystroglycan Partial Recombinant Protein (H00001605-Q01)

Find related products by research area.

Blogs on Dystroglycan.

Could Laminin be Used to Treat Duchenne Muscular Dystrophy?
Duchenne muscular dystrophy (DMD) is a severe muscle wasting condition, causing disability and early death. There is currently no cure or adequate treatment for DMD, but pioneering research indicates that injection of a laminin protein may prevent (or...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Dystroglycan Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DAG1