We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

DYNC1H1 Recombinant Protein Antigen

Images

 
There are currently no images for DYNC1H1 Protein (NBP1-84254PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DYNC1H1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DYNC1H1.

Source: E. coli

Amino Acid Sequence: RSLETCMYDHKTFSEILNRVQKAVDDLNLHSYSNLPIWVNKLDMEIERILGVRLQAGLRAWTQVLLGQAEDKAEVDMDTDAPQVSHKPGGEPKIKNVVHELRITNQVIYLNPPIEECRYKLYQEMFAWKMVVLSLPRIQSQR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DYNC1H1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84254.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DYNC1H1 Recombinant Protein Antigen

  • cytoplasmic dynein 1 heavy chain 1
  • Cytoplasmic dynein heavy chain 1
  • DHC1a
  • DHC1Dynein heavy chain, cytosolic
  • DKFZp686P2245
  • Dnchc1
  • DNCLDNCH1
  • DNECLDYHC
  • dynein, cytoplasmic 1, heavy chain 1
  • dynein, cytoplasmic, heavy polypeptide 1
  • HL-3
  • KIAA0325
  • p22

Background

The DYNC1H1 gene encodes a cytoplasmic dynein 1 heavy chain 1 protein that is 4,646 amino acids long at 532 kDA. Dyneines function as molecular motors that contain ATPase activity. Defects in DYNC1H1 cause Charcot-Marie-Tooth Disease type 2O (CMT2O), mental retardation autosomal dominant type 13 (MRD13), as well as spinal muscular atrophy, lower extremity, autosomal dominant (SMALED). DYNC1H1 has also been investigated by researchers in myeloma, neuropathy, ciliary dyskinesia, lateral sclerosis, intellectual disabilities, lissencephaly, schizophrenia, malaria, and neurodegeneration. DYNC1H1 participates in centrosome maturation, adaptive immune system, cytoplasmic microtubules, cell cycle spindle assembly and chromosome separation, as well as phagosome and vasopressin-regulated water reabsorption. DYNC1H1 interacts with genes HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D, and HIST1H43.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5758
Species: Hu
Applications: ICC, IHC, WB
NBP3-03403
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-89163
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-02300
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-13677
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1904
Species: Hu
Applications: ICC, IHC, WB
NBP1-41012
Species: Hu
Applications: ELISA, Flow-IC, Flow, IHC, IHC-Fr,  IHC-P, WB
NBP2-22377
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-82454
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-05513
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF5675
Species: Hu, Mu, Rt
Applications: IHC, IP, KO, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF2377
Species: Mu
Applications: IHC, Simple Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-790
Species: Ba, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, PEP-ELISA, WB
NB110-58849
Species: Bv, Hu, Mu, Po, Pm, Rb, Rt, Sh
Applications: IB, ICC/IF, IHC, IHC-Fr,  IHC-P, KD, WB
NBP3-13279
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-46085
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-84254PEP
Species: Hu
Applications: AC

Publications for DYNC1H1 Protein (NBP1-84254PEP) (0)

There are no publications for DYNC1H1 Protein (NBP1-84254PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DYNC1H1 Protein (NBP1-84254PEP) (0)

There are no reviews for DYNC1H1 Protein (NBP1-84254PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DYNC1H1 Protein (NBP1-84254PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DYNC1H1 Products

Research Areas for DYNC1H1 Protein (NBP1-84254PEP)

Find related products by research area.

Blogs on DYNC1H1

There are no specific blogs for DYNC1H1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DYNC1H1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DYNC1H1