DUSP9 Antibody (2E3.)

Images

 
Western Blot: DUSP9 Antibody (2E3) [H00001852-M04] - Analysis of DUSP9 expression in HeLa (Cat # L013V1).
Proximity Ligation Assay: DUSP9 Antibody (2E3) [H00001852-M04] - Analysis of protein-protein interactions between MAPK3 and DUSP9. HeLa cells were stained with anti-MAPK3 rabbit purified polyclonal 1:1200 and anti-DUSP9 ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PLA
Clone
2E3.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DUSP9 Antibody (2E3.) Summary

Immunogen
DUSP9 (NP_001386 174 a.a. - 278 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AESEADRDSMSCGLDSEGATPPPVGLRASFPVQILPNLYLGSARDSANLESLAKLGIRYILNVTPNLPNFFEKNGDFHYKQIPISDHWSQNLSRFFPEAIEFIDE
Specificity
DUSP9 (2E3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DUSP9
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DUSP9 Antibody (2E3.)

  • dual specificity phosphatase 9
  • EC 3.1.3.16
  • EC 3.1.3.48
  • MAP kinase phosphatase 4
  • Mitogen-activated protein kinase phosphatase 4
  • MKP-4dual specificity protein phosphatase 9
  • MKP4serine/threonine specific protein phosphatase

Background

The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which is associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product shows selectivity for members of the ERK family of MAP kinases, is expressed only in placenta, kidney, and fetal liver, and is localized to the cytoplasm and nucleus. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-834
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
H00001848-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-31232
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-14934
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
H00001852-M04
Species: Hu
Applications: WB, ELISA, PLA

Publications for DUSP9 Antibody (H00001852-M04) (0)

There are no publications for DUSP9 Antibody (H00001852-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DUSP9 Antibody (H00001852-M04) (0)

There are no reviews for DUSP9 Antibody (H00001852-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DUSP9 Antibody (H00001852-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DUSP9 Products

Bioinformatics Tool for DUSP9 Antibody (H00001852-M04)

Discover related pathways, diseases and genes to DUSP9 Antibody (H00001852-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DUSP9 Antibody (H00001852-M04)

Discover more about diseases related to DUSP9 Antibody (H00001852-M04).
 

Pathways for DUSP9 Antibody (H00001852-M04)

View related products by pathway.

PTMs for DUSP9 Antibody (H00001852-M04)

Learn more about PTMs related to DUSP9 Antibody (H00001852-M04).
 

Research Areas for DUSP9 Antibody (H00001852-M04)

Find related products by research area.

Blogs on DUSP9

There are no specific blogs for DUSP9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DUSP9 Antibody (2E3.) and receive a gift card or discount.

Bioinformatics

Gene Symbol DUSP9
Entrez
OMIM
Uniprot