DRIL1 Antibody [Allophycocyanin]

Product Discontinued

DRIL1 Antibody [Allophycocyanin] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 324-593 of human DRIL1 (NP_005215.1).
  
  Sequence:
  PYECEKRGLSNPNELQAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVSLAGHPVVAAQAAAVQAAAAQAAVAAQAAALEQLREKLESAEPPEKKMALVADEQQRLMQRALQQNFLAMAAQLPMSIRINSQASESRQDSAVNLTGTNGSNSISMSVEINGIMYTGVLFAQPPAPTPTSAPNKGGGGGGGSSSNAGGRGGNTGTSGGQAGPAGLSTPSTSTSNNSLP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARID3A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: PBS
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Alternate Names for DRIL1 Antibody [Allophycocyanin]

• ARID domain-containing 3A
• ARID domain-containing protein 3A
• AT rich interactive domain 3A (BRIGHT- like) protein
• AT rich interactive domain 3A (BRIGHT- like)
• AT rich interactive domain 3A (BRIGHT-like)
• AT-rich interactive domain-containing protein 3A
• B-cell regulator of IgH transcription
• BRIGHT
• dead ringer-like 1
• Dead ringer-like protein 1
• DRIL1dead ringer-like 1 (Drosophila)
• DRIL3
• DRX
• E2F-binding protein 1
• E2FBP1

Background

DRIL1 encodes a member of the ARID (AT-rich interaction domain) family of DNA binding proteins. It was found by homology to the Drosophila dead ringer gene, which is important for normal embryogenesis. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation, and possibly in chromatin structure modification.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARID3A