Draxin/C1orf187 Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: PTMFFLTTFEAAPATEESLILPVTSLRPQQAQPRSDGEVMPTLDMALFDWTDYEDLKPDGWPSAKKKEKHRGKLSSDGNETSPAEGEPCDHHQDCLPGTCCDLREHLCTPHNRGLNNKCFDDCMCVEG |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DRAXIN |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Reactivity Notes
Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (86%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for Draxin/C1orf187 Antibody
Background
Chemorepulsive axon guidance protein required for the development of spinal cord and forebrain commissures.Acts as a chemorepulsive guidance protein for commissural axons during development. Able to inhibit or repel neuriteoutgrowth from dorsal spinal cord. Inhibits the stabilization of cytosolic beta-catenin (CTNNB1) via its interactionwith LRP6, thereby acting as an antagonist of Wnt signaling pathway
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Mu
Applications: Block, IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Block, IHC, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: WB, IHC
Publications for Draxin/C1orf187 Antibody (NBP1-83505) (0)
There are no publications for Draxin/C1orf187 Antibody (NBP1-83505).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Draxin/C1orf187 Antibody (NBP1-83505) (0)
There are no reviews for Draxin/C1orf187 Antibody (NBP1-83505).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Draxin/C1orf187 Antibody (NBP1-83505) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Draxin/C1orf187 Products
Research Areas for Draxin/C1orf187 Antibody (NBP1-83505)
Find related products by research area.
|
Blogs on Draxin/C1orf187