DRAP1 Recombinant Protein Antigen

Images

 
There are currently no images for DRAP1 Protein (NBP1-81008PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DRAP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DRAP1.

Source: E. coli

Amino Acid Sequence: RIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DRAP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81008.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DRAP1 Recombinant Protein Antigen

  • dr1-associated corepressor
  • DR1-associated protein 1 (negative cofactor 2 alpha)
  • Dr1-associated protein 1
  • NC2-alphaNegative co-factor 2-alpha
  • negative cofactor 2 alpha

Background

Transcriptional repression is a general mechanism for regulating transcriptional initiation in organisms ranging from yeast to humans. Accurate initiation of transcription from eukaryotic protein-encoding genes requires the assembly of a large multiprotein complex consisting of RNA polymerase II and general transcription factors such as TFIIA, TFIIB, and TFIID. DR1 is a repressor that interacts with the TATA-binding protein (TBP) of TFIID and prevents the formation of an active transcription complex by precluding the entry of TFIIA and/or TFIIB into the preinitiation complex. The protein encoded by this gene is a corepressor of transcription that interacts with DR1 to enhance DR1-mediated repression. The interaction between this corepressor and DR1 is required for corepressor function and appears to stabilize the TBP-DR1-DNA complex. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47480
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-34143
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, KD, WB
NBP3-38188
Species: Hu, Rt
Applications: ChIP, ELISA, IP, WB
NBL1-08116
Species: Hu
Applications: WB
NBP2-55408
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, WB
NBP1-86953
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P
3218-ND
Species: Hu
Applications: BA
NBP1-83908
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF4248
Species: Hu
Applications: ICC, WB
NBP1-05987
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC,  IHC-P, IP, KD, MiAr, Simple Western, Single-Cell Western, WB
NBP1-84185
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-38323
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00054778-M05
Species: Hu
Applications: ELISA, ICC/IF, KD, WB
NLS272
Species: Ha, Hu, Pm, Mu, Rb, Rt
Applications: IHC, IHC-Fr,  IHC-P
AF3797
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC,  IHC-P

Publications for DRAP1 Protein (NBP1-81008PEP) (0)

There are no publications for DRAP1 Protein (NBP1-81008PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DRAP1 Protein (NBP1-81008PEP) (0)

There are no reviews for DRAP1 Protein (NBP1-81008PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DRAP1 Protein (NBP1-81008PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DRAP1 Products

Blogs on DRAP1

There are no specific blogs for DRAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ZEB1 Antibody
NBP1-05987

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DRAP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DRAP1