DRAK1 Antibody (3G8)

Images

 
Western Blot: DRAK1 Antibody (3G8) [H00009263-M02] - STK17A monoclonal antibody (M02), clone 3G8. Analysis of STK17A expression in Raw 264.7.
Western Blot: DRAK1 Antibody (3G8) [H00009263-M02] - STK17A monoclonal antibody (M02), clone 3G8 Analysis of STK17A expression in NIH/3T3.
Sandwich ELISA: DRAK1 Antibody (3G8) [H00009263-M02] - Detection limit for recombinant GST tagged STK17A is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3G8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DRAK1 Antibody (3G8) Summary

Immunogen
STK17A (AAH47696, 301 a.a. ~ 413 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LLVKKPEDRATAEECLKHPWLTQSSIQEPSFRMEKALEEANALQEGHSVPEINSDTDKSETEESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQEIPGEFI
Specificity
STK17A - serine/threonine kinase 17a (apoptosis-inducing) (3G8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
STK17A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DRAK1 Antibody (3G8)

  • DAP kinase-related apoptosis-inducing protein kinase 1
  • DRAK1
  • DRAK1death-associated protein kinase-related 1
  • EC 2.7.11.1
  • serine/threonine kinase 17a (apoptosis-inducing)
  • serine/threonine kinase 17a
  • serine/threonine-protein kinase 17A
  • STK17A

Background

This gene is a member of the DAP kinase-related apoptosis-inducing protein kinase family and encodes an autophosphorylated nuclear protein with a protein kinase domain. The protein has apoptosis-inducing activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92897
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB6640
Species: Hu, Mu, Rt
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-33680
Species: Hu
Applications: IHC, IHC-P
NBP1-91684
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
462-TR/CF
Species: Mu
Applications: BA
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-84074
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-52452
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NBP1-76652
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-89396
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-02477
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
DFS00
Species: Hu
Applications: ELISA
NBP1-56937
Species: Hu
Applications: WB
H00004499-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
H00004496-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBL1-13348
Species: Hu
Applications: WB
H00004495-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB

Publications for DRAK1 Antibody (H00009263-M02) (0)

There are no publications for DRAK1 Antibody (H00009263-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DRAK1 Antibody (H00009263-M02) (0)

There are no reviews for DRAK1 Antibody (H00009263-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DRAK1 Antibody (H00009263-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DRAK1 Products

Bioinformatics Tool for DRAK1 Antibody (H00009263-M02)

Discover related pathways, diseases and genes to DRAK1 Antibody (H00009263-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DRAK1 Antibody (H00009263-M02)

Discover more about diseases related to DRAK1 Antibody (H00009263-M02).
 

Pathways for DRAK1 Antibody (H00009263-M02)

View related products by pathway.

PTMs for DRAK1 Antibody (H00009263-M02)

Learn more about PTMs related to DRAK1 Antibody (H00009263-M02).
 

Research Areas for DRAK1 Antibody (H00009263-M02)

Find related products by research area.

Blogs on DRAK1

There are no specific blogs for DRAK1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DRAK1 Antibody (3G8) and receive a gift card or discount.

Bioinformatics

Gene Symbol STK17A
Entrez
Uniprot