DPP8 Antibody (1B10) - Azide and BSA Free

Sandwich ELISA: DPP8 Antibody (1B10) [H00054878-M01] - Detection limit for recombinant GST tagged DPP8 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA
• Clone: 1B10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

DPP8 Antibody (1B10) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse DPP8 Antibody (1B10) - Azide and BSA Free (H00054878-M01) is a monoclonal antibody validated for use in ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: DPP8 (NP_932065.1, 161 a.a. ~ 244 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IGTVGIASYDYHQGSGTFLFQAGSGIYHVKDGGPQGFTQQPLRPNLVETSCPNIRMDPKLCPADPDWIAFIHSNDIWISNIVTR
• Specificity: DPP8 - dipeptidyl-peptidase 8 (1B10)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: DPP8
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
• Application Notes: This product is useful for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DPP8 Antibody (1B10) - Azide and BSA Free

• dipeptidyl peptidase 8
• Dipeptidyl peptidase IV-related protein 1
• dipeptidyl peptidase IV-related protein-1
• dipeptidylpeptidase 8
• dipeptidyl-peptidase 8
• DP8
• DP8Dipeptidyl peptidase VIII
• DPP VIII
• DPP8
• DPRP1
• DPRP-1
• DPRP1Prolyl dipeptidase DPP8
• EC 3.4.14.5
• FLJ14920
• FLJ20283
• MGC26191
• MSTP097
• MSTP135
• MSTP141

Background

This gene encodes a member of the peptidase S9B family, a small family of dipeptidyl peptidases that are able to cleave peptide substrates at a prolyl bond. The encoded protein shares similarity with dipeptidyl peptidase IV in that it is ubiquitously expressed, and hydrolyzes the same substrates. These similarities suggest that, like dipeptidyl peptidase IV, this protein may play a role in T-cell activation and immune function. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DPP8
• Entrez:
  • 54878(Human)
• Uniprot:
  • NP_932065(Human)