![Western Blot: DOCK6 Antibody [NBP2-33566] - 293T cell line transfected with Dock6 expression vector and Dock6-specific siRNA as a control for detection. Beta-actin was used as a loading control. Image from a verified customer review.](http://images.novusbio.com/fullsize/DOCK6-Antibody-Western-Blot-NBP2-33566-img0002.jpg "Western Blot: DOCK6 Antibody [NBP2-33566] - 293T cell line transfected with Dock6 expression vector and Dock6-specific siRNA as a control for detection. Beta-actin was used as a loading control. Image from a verified customer review.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC, Mycoplasma |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit DOCK6 Antibody - BSA Free (NBP2-33566) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GAFEAMAHVVSLVHRSLEAAQDARGHCPQLAAYVHYAFRLPGTEPSLPDGAPPVTVQAATLARGSGRPASLYLARSKSISSSNPDLAVAPGSVDDEVSRILA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DOCK6 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunohistochemistry Carboxypeptidase B2/CPB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Carboxypeptidase_B2_AF6036_Immunohistochemistry_19701.jpg)
![Western Blot Carboxypeptidase B2/CPB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Carboxypeptidase_B2_AF6036_Western_Blot_9521.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Darren Richard |
WB | Human | 10/02/2017 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: DOCK6 Antibody [NBP2-33566] - Staining of human small intestine shows moderate granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/DOCK6-Antibody-Immunohistochemistry-Paraffin-NBP2-33566-img0005.jpg "Immunohistochemistry-Paraffin: DOCK6 Antibody [NBP2-33566] - Staining of human small intestine shows moderate granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: DOCK6 Antibody [NBP2-33566] - Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neuronal cells.](http://images.novusbio.com/fullsize/DOCK6-Antibody-Immunohistochemistry-Paraffin-NBP2-33566-img0003.jpg "Immunohistochemistry-Paraffin: DOCK6 Antibody [NBP2-33566] - Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neuronal cells.")
![Immunohistochemistry-Paraffin: DOCK6 Antibody [NBP2-33566] - Staining of human lung shows moderate granular cytoplasmic positivity in macrophages.](http://images.novusbio.com/fullsize/DOCK6-Antibody-Immunohistochemistry-Paraffin-NBP2-33566-img0004.jpg "Immunohistochemistry-Paraffin: DOCK6 Antibody [NBP2-33566] - Staining of human lung shows moderate granular cytoplasmic positivity in macrophages.")
![Immunohistochemistry-Paraffin: DOCK6 Antibody [NBP2-33566] - Staining of human testis shows strong granular cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/fullsize/DOCK6-Antibody-Immunohistochemistry-Paraffin-NBP2-33566-img0006.jpg "Immunohistochemistry-Paraffin: DOCK6 Antibody [NBP2-33566] - Staining of human testis shows strong granular cytoplasmic positivity in Leydig cells.")
![Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunocytochemistry__Immunofluorescence_20674.jpg)
![Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunohistochemistry_20779.jpg)
![Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Western_Blot_5715.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
