Recombinant Human DNASE1L3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DNASE1L3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-305 of Human DNASE1L3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSRELAPLLLLLLSIHSALAMRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
DNASE1L3

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DNASE1L3 Protein

  • deoxyribonuclease gamma
  • deoxyribonuclease I-like 3Liver and spleen DNase
  • deoxyribonuclease I-like III
  • DNAS1L3LSDDHP2
  • DNase gamma
  • DNase I homolog protein 2
  • DNase I homolog protein DHP2
  • DNase I-like 3
  • EC 3.1.21.-
  • EC 3.1.21.1
  • LS-DNase

Background

This gene encodes a member of the DNase family. The protein hydrolyzes DNA, is not inhibited by actin, and mediates the breakdown of DNA during apoptosis. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB120-13592
Species: Hu
Applications: WB
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-91429
Species: Rt
Applications: WB
NBP2-49678
Species: Hu
Applications: IHC
NBP1-76471
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NB100-74340
Species: Hu, Mu, Rt, Bv, ChHa, Dr, Fu, Pl, Pr, Rb, Sh, Xp, Ye, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-03828
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-150
Species: Hu, Mu
Applications: WB, ICC/IF, IP
H00001776-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for DNASE1L3 Recombinant Protein (H00001776-P01) (0)

There are no publications for DNASE1L3 Recombinant Protein (H00001776-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNASE1L3 Recombinant Protein (H00001776-P01) (0)

There are no reviews for DNASE1L3 Recombinant Protein (H00001776-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNASE1L3 Recombinant Protein (H00001776-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DNASE1L3 Products

Bioinformatics Tool for DNASE1L3 Recombinant Protein (H00001776-P01)

Discover related pathways, diseases and genes to DNASE1L3 Recombinant Protein (H00001776-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNASE1L3 Recombinant Protein (H00001776-P01)

Discover more about diseases related to DNASE1L3 Recombinant Protein (H00001776-P01).
 

Pathways for DNASE1L3 Recombinant Protein (H00001776-P01)

View related products by pathway.

PTMs for DNASE1L3 Recombinant Protein (H00001776-P01)

Learn more about PTMs related to DNASE1L3 Recombinant Protein (H00001776-P01).

Blogs on DNASE1L3

There are no specific blogs for DNASE1L3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DNASE1L3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DNASE1L3