![Western Blot: DNASE1L3 Antibody [NBP2-84008] - Host: Rabbit. Target Name: DNASE1L3. Sample Tissue: Human MCF7 Whole Cell. Antibody Dilution: 1ug/ml](http://images.novusbio.com/fullsize/DNASE1L3-Antibody-Western-Blot-NBP2-84008-img0002.jpg "Western Blot: DNASE1L3 Antibody [NBP2-84008] - Host: Rabbit. Target Name: DNASE1L3. Sample Tissue: Human MCF7 Whole Cell. Antibody Dilution: 1ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal DNASE1L3. Peptide sequence: DFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DNASE1L3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for DNASE1L3 Antibody (NBP2-84008)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DNASE1L3 |
![Western Blot: DNASE1L3 Antibody [NBP2-84008] - WB Suggested Anti-DNASE1L3 Antibody. Titration: 1.0 ug/ml. Positive Control: Placenta](http://images.novusbio.com/fullsize/DNASE1L3-Antibody-Western-Blot-NBP2-84008-img0001.jpg "Western Blot: DNASE1L3 Antibody [NBP2-84008] - WB Suggested Anti-DNASE1L3 Antibody. Titration: 1.0 ug/ml. Positive Control: Placenta")
![Western Blot: DNASE1L3 Antibody [NBP2-84008] - Host: Rabbit. Target: DNASE1L3. Positive control (+): Human liver (LI). Negative control (-): Human lung (LU). Antibody concentration: 3ug/ml](http://images.novusbio.com/fullsize/DNASE1L3-Antibody-Western-Blot-NBP2-84008-img0003.jpg "Western Blot: DNASE1L3 Antibody [NBP2-84008] - Host: Rabbit. Target: DNASE1L3. Positive control (+): Human liver (LI). Negative control (-): Human lung (LU). Antibody concentration: 3ug/ml")
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")