DNAJC6 Antibody - BSA Free

Western Blot: DNAJC6 Antibody [NBP2-87291] - Host: Rabbit. Target Name: DNAJC6. Sample Type: MDA-MB-435s Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

DNAJC6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DNAJC6 Antibody - BSA Free (NBP2-87291) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human DNAJC6. Peptide sequence: GGAYNWQQPQPKPQPSMPHSSPQNRPNYNVSFSAMPGGQNERGKGSSNLE The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DNAJC6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for DNAJC6 Antibody - BSA Free

• DJC6
• DnaJ (Hsp40) homolog, subfamily B, member 6
• DnaJ (Hsp40) homolog, subfamily C, member 6
• DnaJ homolog subfamily C member 6
• EC 3.1.3.48
• KIAA0473auxilin
• MGC129914
• MGC129915
• MGC48436
• putative tyrosine-protein phosphatase auxilin

Background

DNAJC6 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus, a glycine/phenylalanine (G/F)-rich region, and a cysteine-rich domain containing 4 motifs resembling a zinc finger domain (Ohtsuka and Hata, 2000 [PubMed 11147971]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DNAJC6