DNAJC19 Antibody

Images

 
Western Blot: DNAJC19 Antibody [NBP1-68991] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNAJC19 Antibody Summary

Immunogen
Synthetic peptides corresponding to DNAJC19 (DnaJ (Hsp40) homolog, subfamily C, member 19) The peptide sequence was selected from the C terminal of DNAJC19. Peptide sequence LGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK.
Specificity
This product is specific to Subunit or Isofrom: TIM14.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNAJC19
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against DNAJC19 and was validated on Western blot.
Theoretical MW
13 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DNAJC19 Antibody

  • DnaJ (Hsp40) homolog, subfamily C, member 19
  • DnaJ homolog subfamily C member 19
  • homolog of yeast TIM14
  • mitochondrial import inner membrane translocase subunit TIM14
  • Tim14
  • TIMM14TIM14Pam18

Background

The protein encoded by this gene is thought to be part of a complex involved in the ATP-dependent transport of transit peptide-containing proteins from the inner cell membrane to the mitochondrial matrix. Defects in this gene are a cause of 3-methylglutaconic aciduria type 5 (MGA5), also known as dilated cardiomyopathy with ataxia (DCMA). Several transcript variants, some protein-coding and some not, have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-98528
Species: Hu
Applications: WB
NBP1-86941
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-97841
Species: Hu
Applications: IP (-), WB
NBP2-34075
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80681
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-131
Species: Hu, Mu, Rt, Po, Av, Bv, Ma
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4377
Species: Hu, Mu
Applications: WB, ICC
NBP1-97503
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Md, Pm, Rb, Sh, Xp
Applications: WB, IHC, IHC-P, IP
NBP2-57763
Species: Hu
Applications: ICC/IF
NBP2-38791
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PP-H7431-00
Species: Hu
Applications: WB
NBP1-80680
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92509
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-68991
Species: Hu
Applications: WB

Publications for DNAJC19 Antibody (NBP1-68991) (0)

There are no publications for DNAJC19 Antibody (NBP1-68991).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAJC19 Antibody (NBP1-68991) (0)

There are no reviews for DNAJC19 Antibody (NBP1-68991). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNAJC19 Antibody (NBP1-68991) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNAJC19 Products

Bioinformatics Tool for DNAJC19 Antibody (NBP1-68991)

Discover related pathways, diseases and genes to DNAJC19 Antibody (NBP1-68991). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNAJC19 Antibody (NBP1-68991)

Discover more about diseases related to DNAJC19 Antibody (NBP1-68991).
 

Pathways for DNAJC19 Antibody (NBP1-68991)

View related products by pathway.

Research Areas for DNAJC19 Antibody (NBP1-68991)

Find related products by research area.

Blogs on DNAJC19

There are no specific blogs for DNAJC19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNAJC19 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAJC19
Uniprot