DNAJB13 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

DNAJB13 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DNAJB13.
  
  

  Source: E. coli

  Amino Acid Sequence: WTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNFGGLQGRGVKKQDPQVERDLYLSLE

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: DNAJB13
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68770.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DNAJB13 Recombinant Protein Antigen

• DnaJ (Hsp40) homolog, subfamily B, member 13,1700014P03Rik
• DnaJ (Hsp40) related, subfamily B, member 13
• dnaJ homolog subfamily B member 13
• DnaJ-like protein
• radial spoke 16 homolog A
• RSPH16A
• Testis and spermatogenesis cell-related protein 6
• Testis spermatocyte apoptosis-related gene 6 protein
• Testis spermatogenesis apoptosis-related gene 3 protein
• Testis spermatogenesis apoptosis-related gene 6 protein
• testis spermatogenesis apoptosis-related protein 6
• TSARG3
• TSARG5
• TSARG6FLJ46748

Background

DNAJB13, also known as DnaJ homolog subfamily B member 13, consists of a 36.1 kDa and a 16.1 kDa isoform and is involved in regulating molecular activity as a member of the DNAJ/HSP40 family as well as inhibiting apoptosis during testis spermatogenesis. Current research is being conducted on diseases and disorders such as pneumonia, malaria, mycobacterium tuberculosis, and cryptorchidism. The protein interacts with STIP1. No known pathways are listed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: DNAJB13